Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2APP1

Protein Details
Accession B2APP1    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
142-176PQPQPQPQPRPRYHHHRDRQRNRQRNQRGASPRAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 5, cyto 2
Family & Domain DBs
KEGG pan:PODANSg2697  -  
Amino Acid Sequences MVIDQLILSLHKGRWRESTLSVEPNVFRTRKSNTITMSYNPSYQGQPPNDGIQQNNPNRSHGSPQFTVTRDELQQIFYDIGFPPASISNAWHPQVNPNYNSYGNPQSDLQRSVPSAWHPQVNPNPLLLRIEVPTKCNGNSNPQPQPQPQPRPRYHHHRDRQRNRQRNQRGASPRAPQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.37
4 0.38
5 0.44
6 0.45
7 0.48
8 0.46
9 0.42
10 0.37
11 0.38
12 0.4
13 0.32
14 0.28
15 0.28
16 0.33
17 0.38
18 0.42
19 0.42
20 0.39
21 0.45
22 0.46
23 0.44
24 0.46
25 0.39
26 0.36
27 0.32
28 0.31
29 0.27
30 0.28
31 0.33
32 0.28
33 0.3
34 0.3
35 0.32
36 0.33
37 0.33
38 0.3
39 0.3
40 0.37
41 0.38
42 0.44
43 0.41
44 0.4
45 0.41
46 0.42
47 0.41
48 0.37
49 0.38
50 0.32
51 0.34
52 0.36
53 0.34
54 0.35
55 0.3
56 0.27
57 0.22
58 0.23
59 0.2
60 0.17
61 0.16
62 0.14
63 0.12
64 0.1
65 0.1
66 0.08
67 0.09
68 0.08
69 0.08
70 0.07
71 0.08
72 0.08
73 0.07
74 0.09
75 0.1
76 0.14
77 0.15
78 0.15
79 0.15
80 0.2
81 0.26
82 0.28
83 0.26
84 0.24
85 0.26
86 0.26
87 0.27
88 0.25
89 0.24
90 0.21
91 0.21
92 0.21
93 0.22
94 0.24
95 0.25
96 0.23
97 0.19
98 0.2
99 0.2
100 0.2
101 0.2
102 0.24
103 0.23
104 0.26
105 0.24
106 0.31
107 0.36
108 0.39
109 0.36
110 0.31
111 0.3
112 0.27
113 0.28
114 0.21
115 0.17
116 0.14
117 0.19
118 0.18
119 0.2
120 0.23
121 0.24
122 0.23
123 0.28
124 0.28
125 0.32
126 0.39
127 0.45
128 0.5
129 0.52
130 0.57
131 0.55
132 0.64
133 0.64
134 0.67
135 0.67
136 0.7
137 0.72
138 0.75
139 0.79
140 0.8
141 0.8
142 0.8
143 0.82
144 0.83
145 0.87
146 0.9
147 0.93
148 0.94
149 0.94
150 0.92
151 0.92
152 0.92
153 0.91
154 0.86
155 0.85
156 0.83
157 0.81
158 0.79