Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2WVK7

Protein Details
Accession F2WVK7   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
286-306NITIKSCKISIKKNNVKKLMDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 9, cyto_nucl 9, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR017964  DNA-dir_DNA_pol_B_CS  
IPR004868  DNA-dir_DNA_pol_B_mt/vir  
IPR043502  DNA/RNA_pol_sf  
IPR023211  DNA_pol_palm_dom_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003677  F:DNA binding  
GO:0003887  F:DNA-directed DNA polymerase activity  
GO:0000166  F:nucleotide binding  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF03175  DNA_pol_B_2  
PROSITE View protein in PROSITE  
PS00116  DNA_POLYMERASE_B  
Amino Acid Sequences MIPLLPYKYQGKTIFPKGKWIGVYFSEELKVVQNYGYKISLIKGYEFSKIDLFKEYVLHFYDKKKYANSPAEKLIAKMHLNQLYGIFGRKQELLETINVLNKDIPIYLSTRIIKSIIEINDNISALLLVNNINVDILKDLNNTLNINLKNNTSKRFNVKSNVALASAVTSYARIHMMKYKINNNIYYTDTDSIFIDKPLPNNEIGKDLGLMKDELEGNIIEEAYFFGIKQYGYYYFNKKNEKVEKSVFAGIKRDSLTFKEIELIFNNVVLTKEIPIRFYKSFKDLNITIKSCKISIKKNNVKKLMDNNYYPIYVNNLNHELDNRTFLTKLKNKISKFFKNFMKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.57
3 0.64
4 0.6
5 0.61
6 0.57
7 0.5
8 0.44
9 0.38
10 0.43
11 0.35
12 0.33
13 0.29
14 0.26
15 0.24
16 0.23
17 0.21
18 0.16
19 0.17
20 0.19
21 0.19
22 0.22
23 0.22
24 0.19
25 0.19
26 0.2
27 0.22
28 0.2
29 0.2
30 0.22
31 0.23
32 0.28
33 0.28
34 0.28
35 0.29
36 0.29
37 0.28
38 0.27
39 0.26
40 0.22
41 0.24
42 0.23
43 0.22
44 0.23
45 0.25
46 0.24
47 0.29
48 0.37
49 0.39
50 0.41
51 0.42
52 0.45
53 0.51
54 0.59
55 0.59
56 0.55
57 0.55
58 0.56
59 0.52
60 0.48
61 0.42
62 0.37
63 0.32
64 0.31
65 0.33
66 0.32
67 0.32
68 0.32
69 0.28
70 0.25
71 0.24
72 0.22
73 0.16
74 0.13
75 0.15
76 0.15
77 0.15
78 0.14
79 0.16
80 0.16
81 0.15
82 0.17
83 0.16
84 0.18
85 0.18
86 0.17
87 0.15
88 0.13
89 0.13
90 0.11
91 0.1
92 0.08
93 0.1
94 0.11
95 0.15
96 0.17
97 0.17
98 0.17
99 0.17
100 0.16
101 0.15
102 0.2
103 0.17
104 0.17
105 0.17
106 0.18
107 0.19
108 0.19
109 0.17
110 0.11
111 0.09
112 0.07
113 0.07
114 0.06
115 0.04
116 0.04
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.05
124 0.06
125 0.06
126 0.07
127 0.08
128 0.1
129 0.1
130 0.1
131 0.16
132 0.15
133 0.18
134 0.18
135 0.19
136 0.24
137 0.26
138 0.3
139 0.28
140 0.31
141 0.36
142 0.4
143 0.42
144 0.41
145 0.42
146 0.41
147 0.4
148 0.37
149 0.3
150 0.24
151 0.2
152 0.15
153 0.12
154 0.09
155 0.05
156 0.05
157 0.04
158 0.05
159 0.07
160 0.06
161 0.07
162 0.13
163 0.16
164 0.18
165 0.22
166 0.27
167 0.33
168 0.35
169 0.36
170 0.33
171 0.32
172 0.31
173 0.29
174 0.25
175 0.2
176 0.17
177 0.16
178 0.14
179 0.14
180 0.13
181 0.11
182 0.13
183 0.12
184 0.14
185 0.16
186 0.17
187 0.17
188 0.18
189 0.18
190 0.17
191 0.17
192 0.15
193 0.13
194 0.12
195 0.11
196 0.1
197 0.1
198 0.07
199 0.09
200 0.09
201 0.08
202 0.09
203 0.08
204 0.08
205 0.08
206 0.08
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.06
215 0.06
216 0.07
217 0.09
218 0.1
219 0.14
220 0.19
221 0.26
222 0.32
223 0.4
224 0.46
225 0.47
226 0.54
227 0.59
228 0.6
229 0.59
230 0.56
231 0.53
232 0.5
233 0.54
234 0.47
235 0.39
236 0.38
237 0.33
238 0.32
239 0.29
240 0.27
241 0.22
242 0.23
243 0.25
244 0.21
245 0.2
246 0.22
247 0.21
248 0.22
249 0.22
250 0.22
251 0.19
252 0.19
253 0.18
254 0.13
255 0.13
256 0.12
257 0.12
258 0.1
259 0.16
260 0.16
261 0.19
262 0.21
263 0.26
264 0.29
265 0.32
266 0.34
267 0.34
268 0.38
269 0.37
270 0.41
271 0.39
272 0.43
273 0.48
274 0.46
275 0.43
276 0.43
277 0.43
278 0.37
279 0.41
280 0.39
281 0.41
282 0.49
283 0.58
284 0.64
285 0.72
286 0.8
287 0.82
288 0.8
289 0.77
290 0.77
291 0.76
292 0.72
293 0.65
294 0.6
295 0.55
296 0.52
297 0.44
298 0.35
299 0.3
300 0.29
301 0.28
302 0.29
303 0.3
304 0.29
305 0.3
306 0.32
307 0.31
308 0.26
309 0.29
310 0.25
311 0.24
312 0.24
313 0.25
314 0.34
315 0.36
316 0.43
317 0.49
318 0.56
319 0.57
320 0.66
321 0.73
322 0.74
323 0.74
324 0.74