Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2WB14

Protein Details
Accession V2WB14    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
179-207IDDWIHKRDREKKKDHKPNGKPKPSNDTEBasic
NLS Segment(s)
PositionSequence
185-201KRDREKKKDHKPNGKPK
Subcellular Location(s) nucl 14, cyto 6, mito 4, pero 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR005162  Retrotrans_gag_dom  
KEGG mrr:Moror_11544  -  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
Amino Acid Sequences THLTQLRAPDDGLKGVPKFKEPKIFDGKASSVTQFLQDIKNAIQLSRRSLVSDHDKCLYFSTYLGSGAPKEWYNSVELNNRTLLDDFAKFIESFKKHFGDSNIVATAQSKLDDLYQTGSAAQYIARFNEWVIHLDLTNASKIHMLYRHLKTSVKDAITFVPKTTRPTKFKEYCDFITEIDDWIHKRDREKKKDHKPNGKPKPSNDTEPSNTPSISTTMPSSSEPMEIDATK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.3
4 0.32
5 0.36
6 0.4
7 0.48
8 0.47
9 0.54
10 0.59
11 0.59
12 0.55
13 0.55
14 0.5
15 0.45
16 0.43
17 0.35
18 0.27
19 0.25
20 0.24
21 0.2
22 0.2
23 0.18
24 0.17
25 0.18
26 0.17
27 0.22
28 0.21
29 0.2
30 0.24
31 0.24
32 0.28
33 0.29
34 0.29
35 0.25
36 0.25
37 0.31
38 0.35
39 0.37
40 0.35
41 0.35
42 0.35
43 0.34
44 0.36
45 0.32
46 0.22
47 0.18
48 0.17
49 0.14
50 0.14
51 0.14
52 0.12
53 0.1
54 0.11
55 0.13
56 0.11
57 0.11
58 0.12
59 0.12
60 0.14
61 0.15
62 0.18
63 0.23
64 0.24
65 0.24
66 0.24
67 0.24
68 0.22
69 0.21
70 0.18
71 0.13
72 0.12
73 0.11
74 0.11
75 0.12
76 0.11
77 0.11
78 0.18
79 0.17
80 0.19
81 0.22
82 0.23
83 0.22
84 0.24
85 0.26
86 0.25
87 0.24
88 0.25
89 0.21
90 0.2
91 0.19
92 0.17
93 0.16
94 0.1
95 0.09
96 0.06
97 0.06
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.07
104 0.07
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07
114 0.07
115 0.11
116 0.11
117 0.11
118 0.12
119 0.12
120 0.11
121 0.12
122 0.13
123 0.1
124 0.11
125 0.09
126 0.08
127 0.09
128 0.09
129 0.11
130 0.13
131 0.16
132 0.23
133 0.27
134 0.3
135 0.3
136 0.33
137 0.31
138 0.34
139 0.37
140 0.3
141 0.28
142 0.25
143 0.28
144 0.31
145 0.3
146 0.25
147 0.24
148 0.25
149 0.29
150 0.36
151 0.41
152 0.4
153 0.47
154 0.57
155 0.59
156 0.64
157 0.67
158 0.65
159 0.59
160 0.59
161 0.53
162 0.42
163 0.38
164 0.32
165 0.25
166 0.19
167 0.19
168 0.15
169 0.18
170 0.24
171 0.23
172 0.3
173 0.4
174 0.5
175 0.58
176 0.68
177 0.75
178 0.8
179 0.89
180 0.92
181 0.93
182 0.93
183 0.94
184 0.94
185 0.95
186 0.9
187 0.85
188 0.85
189 0.79
190 0.77
191 0.71
192 0.68
193 0.62
194 0.61
195 0.59
196 0.51
197 0.45
198 0.37
199 0.33
200 0.27
201 0.24
202 0.2
203 0.18
204 0.17
205 0.19
206 0.2
207 0.21
208 0.2
209 0.2
210 0.19
211 0.19