Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WAG6

Protein Details
Accession V2WAG6   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAHKKTRKPHGKPQWPKSPKLSBasic
NLS Segment(s)
PositionSequence
4-16KKTRKPHGKPQWP
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 9, cyto 4
Family & Domain DBs
KEGG mrr:Moror_13562  -  
Amino Acid Sequences MAHKKTRKPHGKPQWPKSPKLSYLEGMKAEYDSNPGKMYRKVAKYFVDMWGTALKLEEEPISDFNYADPNISTFPEGPERDTEIQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.85
3 0.82
4 0.79
5 0.76
6 0.7
7 0.64
8 0.58
9 0.5
10 0.5
11 0.49
12 0.41
13 0.33
14 0.28
15 0.24
16 0.2
17 0.17
18 0.16
19 0.13
20 0.13
21 0.14
22 0.14
23 0.16
24 0.18
25 0.23
26 0.26
27 0.31
28 0.32
29 0.35
30 0.36
31 0.37
32 0.37
33 0.34
34 0.29
35 0.23
36 0.22
37 0.19
38 0.17
39 0.13
40 0.12
41 0.09
42 0.07
43 0.08
44 0.07
45 0.07
46 0.09
47 0.1
48 0.12
49 0.12
50 0.12
51 0.11
52 0.15
53 0.14
54 0.13
55 0.13
56 0.12
57 0.13
58 0.14
59 0.16
60 0.12
61 0.16
62 0.23
63 0.23
64 0.24
65 0.26
66 0.32