Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2B5N9

Protein Details
Accession B2B5N9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKATRKPTGPRRNEPLPSBasic
NLS Segment(s)
PositionSequence
3-16KRKKATRKPTGPRR
Subcellular Location(s) mito 14, cyto 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003746  F:translation elongation factor activity  
KEGG pan:PODANSg8331  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKATRKPTGPRRNEPLPSVFTCLFCNHEKAVSVKVDKKAGVGSLDCKICGQHFQCGINYLSAPVDVYAEWVDAADAVAQENSEKAKAAGAGGRSSNSGGRAARRVEADDDEDGYGDVIPDDDDYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.88
3 0.85
4 0.79
5 0.72
6 0.66
7 0.61
8 0.54
9 0.51
10 0.44
11 0.36
12 0.33
13 0.3
14 0.29
15 0.25
16 0.26
17 0.21
18 0.21
19 0.21
20 0.21
21 0.24
22 0.24
23 0.27
24 0.29
25 0.32
26 0.33
27 0.32
28 0.31
29 0.27
30 0.24
31 0.21
32 0.17
33 0.15
34 0.17
35 0.17
36 0.16
37 0.15
38 0.14
39 0.13
40 0.18
41 0.17
42 0.17
43 0.2
44 0.21
45 0.21
46 0.23
47 0.23
48 0.18
49 0.17
50 0.12
51 0.09
52 0.08
53 0.08
54 0.05
55 0.05
56 0.04
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.05
72 0.06
73 0.05
74 0.06
75 0.06
76 0.07
77 0.07
78 0.08
79 0.1
80 0.11
81 0.13
82 0.13
83 0.14
84 0.14
85 0.15
86 0.15
87 0.14
88 0.16
89 0.16
90 0.19
91 0.23
92 0.24
93 0.26
94 0.27
95 0.28
96 0.27
97 0.29
98 0.28
99 0.25
100 0.24
101 0.22
102 0.2
103 0.17
104 0.14
105 0.11
106 0.08
107 0.07
108 0.05
109 0.05