Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2X6N6

Protein Details
Accession V2X6N6   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-30FTCGHRARFKRERVDCNNRYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
KEGG mrr:Moror_14152  -  
Amino Acid Sequences MCFLINGERQFTCGHRARFKRERVDCNNRYCAISRSHRYTEAHDCATECEQNLKPDQDIIFGRVNRLCDECLNPIAPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.47
4 0.56
5 0.63
6 0.69
7 0.71
8 0.72
9 0.76
10 0.76
11 0.81
12 0.78
13 0.76
14 0.74
15 0.64
16 0.58
17 0.49
18 0.42
19 0.38
20 0.39
21 0.37
22 0.37
23 0.38
24 0.4
25 0.4
26 0.41
27 0.43
28 0.39
29 0.35
30 0.29
31 0.27
32 0.25
33 0.26
34 0.23
35 0.15
36 0.17
37 0.17
38 0.2
39 0.23
40 0.22
41 0.2
42 0.22
43 0.22
44 0.21
45 0.2
46 0.22
47 0.25
48 0.24
49 0.27
50 0.26
51 0.28
52 0.26
53 0.27
54 0.25
55 0.22
56 0.26
57 0.27
58 0.28