Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AL77

Protein Details
Accession B2AL77    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
231-269RVLHPLRQKRSPRPGLQRPSPHRLHPPRHRRELHLLQKRBasic
NLS Segment(s)
PositionSequence
209-268EPRPPRQHLPRHLLHLRPVHAGRVLHPLRQKRSPRPGLQRPSPHRLHPPRHRRELHLLQK
Subcellular Location(s) nucl 16, mito 5, extr 3, cyto 2
Family & Domain DBs
KEGG pan:PODANSg1830  -  
Amino Acid Sequences MYATLDIQSLVLLPINVATTPHHTTVHHLPWFVHTSSESTSGSSSLLILWSYGASILTPTKTPVILAIINTQDAEYEKKFTMAWSTMQTSSSTSSGPTKPAIGSLGQFSINSSPSKSQCKNYKYNLHHPHQSHHLHPSSSYTSTQPNQPTTKMHLSLTSLVSLLAAAQSASAWQSTSTTPPPFALFPITNLFHSHRLRRQQNLQRPGPEPRPPRQHLPRHLLHLRPVHAGRVLHPLRQKRSPRPGLQRPSPHRLHPPRHRRELHLLQKRGLHWRPDLEERRQRLRYLWRSHHHWILQVQHPLRAGLCFRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.09
5 0.11
6 0.15
7 0.2
8 0.22
9 0.23
10 0.23
11 0.29
12 0.37
13 0.43
14 0.4
15 0.37
16 0.36
17 0.39
18 0.44
19 0.38
20 0.31
21 0.23
22 0.23
23 0.24
24 0.28
25 0.22
26 0.19
27 0.19
28 0.17
29 0.17
30 0.14
31 0.12
32 0.08
33 0.08
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.06
43 0.08
44 0.09
45 0.1
46 0.12
47 0.13
48 0.13
49 0.13
50 0.12
51 0.14
52 0.14
53 0.15
54 0.17
55 0.17
56 0.17
57 0.17
58 0.15
59 0.12
60 0.12
61 0.15
62 0.12
63 0.15
64 0.15
65 0.16
66 0.16
67 0.16
68 0.19
69 0.17
70 0.18
71 0.19
72 0.22
73 0.22
74 0.23
75 0.23
76 0.19
77 0.2
78 0.18
79 0.15
80 0.13
81 0.17
82 0.17
83 0.19
84 0.18
85 0.17
86 0.16
87 0.17
88 0.17
89 0.13
90 0.13
91 0.12
92 0.13
93 0.11
94 0.11
95 0.11
96 0.12
97 0.12
98 0.12
99 0.12
100 0.15
101 0.18
102 0.27
103 0.29
104 0.35
105 0.42
106 0.48
107 0.54
108 0.58
109 0.65
110 0.63
111 0.71
112 0.73
113 0.69
114 0.69
115 0.62
116 0.58
117 0.57
118 0.53
119 0.44
120 0.42
121 0.4
122 0.33
123 0.31
124 0.32
125 0.27
126 0.25
127 0.24
128 0.19
129 0.21
130 0.22
131 0.27
132 0.26
133 0.27
134 0.27
135 0.27
136 0.28
137 0.3
138 0.33
139 0.29
140 0.26
141 0.23
142 0.22
143 0.23
144 0.22
145 0.16
146 0.12
147 0.1
148 0.1
149 0.08
150 0.06
151 0.04
152 0.03
153 0.02
154 0.02
155 0.02
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.05
162 0.06
163 0.09
164 0.13
165 0.13
166 0.14
167 0.15
168 0.16
169 0.15
170 0.15
171 0.16
172 0.13
173 0.14
174 0.17
175 0.18
176 0.17
177 0.19
178 0.21
179 0.24
180 0.27
181 0.31
182 0.34
183 0.43
184 0.47
185 0.51
186 0.6
187 0.62
188 0.69
189 0.72
190 0.71
191 0.66
192 0.64
193 0.65
194 0.61
195 0.59
196 0.55
197 0.54
198 0.59
199 0.58
200 0.65
201 0.68
202 0.71
203 0.71
204 0.73
205 0.69
206 0.67
207 0.69
208 0.61
209 0.58
210 0.54
211 0.48
212 0.46
213 0.42
214 0.36
215 0.34
216 0.32
217 0.27
218 0.32
219 0.31
220 0.3
221 0.36
222 0.42
223 0.44
224 0.53
225 0.59
226 0.59
227 0.69
228 0.73
229 0.77
230 0.8
231 0.84
232 0.84
233 0.85
234 0.85
235 0.82
236 0.81
237 0.76
238 0.71
239 0.71
240 0.72
241 0.73
242 0.74
243 0.77
244 0.79
245 0.85
246 0.84
247 0.8
248 0.8
249 0.8
250 0.8
251 0.79
252 0.74
253 0.67
254 0.68
255 0.64
256 0.64
257 0.59
258 0.53
259 0.48
260 0.5
261 0.52
262 0.57
263 0.61
264 0.61
265 0.65
266 0.66
267 0.71
268 0.68
269 0.64
270 0.61
271 0.65
272 0.65
273 0.66
274 0.69
275 0.68
276 0.72
277 0.77
278 0.78
279 0.69
280 0.65
281 0.6
282 0.58
283 0.57
284 0.59
285 0.54
286 0.49
287 0.48
288 0.43
289 0.38
290 0.34