Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2X8F8

Protein Details
Accession V2X8F8    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
456-476IWEVRNKKRHFTYSKVRQPYRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 13, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR008928  6-hairpin_glycosidase_sf  
IPR012341  6hp_glycosidase-like_sf  
IPR011613  GH15-like  
IPR045582  Trehalase-like_N  
Gene Ontology GO:0016787  F:hydrolase activity  
GO:0005975  P:carbohydrate metabolic process  
KEGG mrr:Moror_5351  -  
Pfam View protein in Pfam  
PF00723  Glyco_hydro_15  
PF19291  TREH_N  
Amino Acid Sequences MQQPYSTERDYIPIADHGLIGNLHTAALVSIDGSIESYCVPNFDSPSIFARILDKDKGGHFCITPTVPFSTKQNYLPSSNVLQTKFMNEMAVVSVTDFLPRQPKGLGSATKPLLHWLIRRVEVIRGGMPLMMECAPAFNYARSSHRTSIIDDNSTLSPQKKALFESNELALDLRYVTDTSLDNVSEPEISLQLLDLSAKGHKGPGVYAKLDLSEGQVVTFVLRTPPNDAREVKGSVIVPIGSSTKSRPIDDPFLTKELVSGLLTSTNKYWLEWIRQSSYSGSWKEAVHRSAFALKLLIFEPTGAVVASPTFSLPEYIGGTRNWDYRASWIRDSSFTLYALIRLGFTTEANAYMDFIFERLRDKNPDGSIQIMYTIHGGKDLEEIELTHLDGHKGSKPVRIGNGAADHLQLDIYGELMDCIYLGQKFGKPLSYDDWVLVRELVDYVVANCKNPDLSIWEVRNKKRHFTYSKVRQPYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.17
5 0.17
6 0.15
7 0.13
8 0.12
9 0.1
10 0.09
11 0.08
12 0.08
13 0.06
14 0.07
15 0.06
16 0.05
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.06
23 0.07
24 0.08
25 0.08
26 0.08
27 0.1
28 0.13
29 0.16
30 0.17
31 0.18
32 0.19
33 0.23
34 0.27
35 0.25
36 0.23
37 0.24
38 0.27
39 0.31
40 0.31
41 0.29
42 0.27
43 0.32
44 0.36
45 0.35
46 0.32
47 0.28
48 0.26
49 0.29
50 0.28
51 0.24
52 0.22
53 0.24
54 0.22
55 0.23
56 0.27
57 0.29
58 0.32
59 0.35
60 0.39
61 0.39
62 0.41
63 0.41
64 0.41
65 0.38
66 0.39
67 0.4
68 0.33
69 0.32
70 0.3
71 0.3
72 0.28
73 0.25
74 0.2
75 0.15
76 0.15
77 0.13
78 0.13
79 0.1
80 0.08
81 0.09
82 0.08
83 0.1
84 0.09
85 0.1
86 0.16
87 0.17
88 0.18
89 0.18
90 0.19
91 0.23
92 0.29
93 0.32
94 0.28
95 0.36
96 0.37
97 0.38
98 0.37
99 0.34
100 0.31
101 0.3
102 0.29
103 0.28
104 0.3
105 0.3
106 0.32
107 0.31
108 0.3
109 0.29
110 0.29
111 0.23
112 0.19
113 0.17
114 0.16
115 0.14
116 0.11
117 0.1
118 0.09
119 0.08
120 0.07
121 0.07
122 0.08
123 0.1
124 0.11
125 0.09
126 0.12
127 0.14
128 0.18
129 0.22
130 0.27
131 0.28
132 0.33
133 0.33
134 0.34
135 0.4
136 0.4
137 0.36
138 0.31
139 0.31
140 0.26
141 0.26
142 0.24
143 0.17
144 0.15
145 0.16
146 0.19
147 0.18
148 0.21
149 0.27
150 0.29
151 0.31
152 0.31
153 0.3
154 0.27
155 0.25
156 0.22
157 0.15
158 0.11
159 0.08
160 0.06
161 0.05
162 0.05
163 0.05
164 0.06
165 0.07
166 0.08
167 0.09
168 0.09
169 0.09
170 0.09
171 0.09
172 0.08
173 0.08
174 0.07
175 0.05
176 0.05
177 0.05
178 0.05
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.05
185 0.06
186 0.06
187 0.07
188 0.08
189 0.08
190 0.09
191 0.15
192 0.17
193 0.18
194 0.18
195 0.18
196 0.17
197 0.17
198 0.16
199 0.11
200 0.09
201 0.08
202 0.07
203 0.07
204 0.07
205 0.07
206 0.07
207 0.05
208 0.06
209 0.07
210 0.08
211 0.13
212 0.18
213 0.2
214 0.24
215 0.25
216 0.24
217 0.27
218 0.28
219 0.23
220 0.21
221 0.19
222 0.15
223 0.14
224 0.12
225 0.09
226 0.08
227 0.09
228 0.07
229 0.08
230 0.08
231 0.15
232 0.16
233 0.18
234 0.19
235 0.23
236 0.28
237 0.29
238 0.32
239 0.27
240 0.27
241 0.26
242 0.23
243 0.19
244 0.14
245 0.13
246 0.1
247 0.07
248 0.06
249 0.1
250 0.1
251 0.11
252 0.11
253 0.13
254 0.13
255 0.13
256 0.16
257 0.15
258 0.21
259 0.24
260 0.27
261 0.27
262 0.28
263 0.29
264 0.27
265 0.27
266 0.27
267 0.24
268 0.23
269 0.22
270 0.21
271 0.26
272 0.29
273 0.28
274 0.23
275 0.23
276 0.23
277 0.24
278 0.23
279 0.19
280 0.15
281 0.13
282 0.13
283 0.13
284 0.12
285 0.08
286 0.08
287 0.08
288 0.06
289 0.07
290 0.05
291 0.04
292 0.04
293 0.04
294 0.04
295 0.04
296 0.04
297 0.04
298 0.05
299 0.06
300 0.06
301 0.08
302 0.09
303 0.1
304 0.12
305 0.12
306 0.16
307 0.17
308 0.19
309 0.19
310 0.18
311 0.18
312 0.23
313 0.32
314 0.32
315 0.33
316 0.33
317 0.34
318 0.34
319 0.37
320 0.34
321 0.26
322 0.22
323 0.21
324 0.19
325 0.17
326 0.17
327 0.13
328 0.1
329 0.08
330 0.09
331 0.08
332 0.07
333 0.09
334 0.08
335 0.09
336 0.09
337 0.09
338 0.09
339 0.09
340 0.09
341 0.07
342 0.08
343 0.08
344 0.07
345 0.11
346 0.13
347 0.17
348 0.23
349 0.26
350 0.32
351 0.33
352 0.37
353 0.34
354 0.34
355 0.31
356 0.25
357 0.24
358 0.18
359 0.16
360 0.14
361 0.14
362 0.11
363 0.12
364 0.12
365 0.1
366 0.13
367 0.13
368 0.12
369 0.11
370 0.11
371 0.12
372 0.13
373 0.12
374 0.11
375 0.11
376 0.11
377 0.12
378 0.14
379 0.16
380 0.21
381 0.23
382 0.27
383 0.3
384 0.34
385 0.38
386 0.39
387 0.36
388 0.36
389 0.38
390 0.34
391 0.3
392 0.26
393 0.21
394 0.17
395 0.16
396 0.11
397 0.08
398 0.06
399 0.06
400 0.06
401 0.05
402 0.05
403 0.05
404 0.05
405 0.04
406 0.04
407 0.06
408 0.06
409 0.08
410 0.11
411 0.14
412 0.17
413 0.19
414 0.24
415 0.24
416 0.27
417 0.31
418 0.32
419 0.31
420 0.29
421 0.3
422 0.26
423 0.25
424 0.22
425 0.17
426 0.13
427 0.13
428 0.11
429 0.09
430 0.09
431 0.09
432 0.17
433 0.17
434 0.18
435 0.18
436 0.2
437 0.2
438 0.2
439 0.2
440 0.17
441 0.23
442 0.31
443 0.36
444 0.43
445 0.51
446 0.58
447 0.67
448 0.65
449 0.68
450 0.68
451 0.74
452 0.72
453 0.73
454 0.77
455 0.78
456 0.84