Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2X7A4

Protein Details
Accession V2X7A4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
125-144DTSFSGKKNGKSAKRKHQKKBasic
NLS Segment(s)
PositionSequence
116-144AQKKRSGGIDTSFSGKKNGKSAKRKHQKK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011709  DEAD-box_helicase_OB_fold  
Gene Ontology GO:0004386  F:helicase activity  
KEGG mrr:Moror_8683  -  
Pfam View protein in Pfam  
PF07717  OB_NTP_bind  
Amino Acid Sequences MERSEVELVSLNDEKKLYMNIRKALVVGFFMQVAHREGEKGSYLTVKDNQVVALHPSCGLDTQPEWVLFNEFVLTKRPYITTVTDVRAEWLLELAPLYFDLNTFPNGETKRALQRAQKKRSGGIDTSFSGKKNGKSAKRKHQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.24
4 0.25
5 0.3
6 0.36
7 0.39
8 0.41
9 0.41
10 0.4
11 0.35
12 0.3
13 0.23
14 0.17
15 0.13
16 0.11
17 0.11
18 0.11
19 0.11
20 0.12
21 0.12
22 0.1
23 0.11
24 0.11
25 0.12
26 0.14
27 0.12
28 0.11
29 0.13
30 0.13
31 0.16
32 0.19
33 0.19
34 0.19
35 0.19
36 0.18
37 0.16
38 0.16
39 0.16
40 0.13
41 0.12
42 0.11
43 0.11
44 0.1
45 0.1
46 0.09
47 0.07
48 0.07
49 0.09
50 0.1
51 0.1
52 0.11
53 0.11
54 0.12
55 0.1
56 0.1
57 0.09
58 0.07
59 0.08
60 0.11
61 0.12
62 0.11
63 0.12
64 0.12
65 0.13
66 0.15
67 0.16
68 0.17
69 0.19
70 0.21
71 0.21
72 0.21
73 0.2
74 0.19
75 0.17
76 0.12
77 0.09
78 0.07
79 0.06
80 0.06
81 0.05
82 0.04
83 0.04
84 0.05
85 0.04
86 0.04
87 0.06
88 0.07
89 0.08
90 0.1
91 0.1
92 0.15
93 0.17
94 0.18
95 0.19
96 0.21
97 0.29
98 0.32
99 0.37
100 0.4
101 0.49
102 0.58
103 0.65
104 0.69
105 0.63
106 0.64
107 0.67
108 0.64
109 0.57
110 0.51
111 0.47
112 0.41
113 0.44
114 0.4
115 0.33
116 0.33
117 0.33
118 0.33
119 0.38
120 0.46
121 0.51
122 0.6
123 0.7
124 0.75