Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F2WVM8

Protein Details
Accession F2WVM8    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-46AKKNPPCKAREGRSRRRIPSBasic
NLS Segment(s)
PositionSequence
28-43KKNPPCKAREGRSRRR
Subcellular Location(s) mito 12, E.R. 4, cyto 3.5, plas 3, cyto_nucl 3, nucl 1.5, extr 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
Amino Acid Sequences MLRCSLKSTASSPPCFLAEQPEGKDGAKKNPPCKAREGRSRRRIPSVSSLPRVAELEEGVGGRKRAWISEVIFLFLIKVSYILTAFYAGRLHKDNYNIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.32
4 0.29
5 0.27
6 0.29
7 0.29
8 0.28
9 0.28
10 0.27
11 0.32
12 0.27
13 0.31
14 0.35
15 0.39
16 0.44
17 0.5
18 0.55
19 0.52
20 0.59
21 0.6
22 0.6
23 0.64
24 0.68
25 0.71
26 0.77
27 0.82
28 0.77
29 0.75
30 0.68
31 0.61
32 0.6
33 0.58
34 0.54
35 0.48
36 0.45
37 0.37
38 0.36
39 0.33
40 0.24
41 0.15
42 0.1
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.07
49 0.07
50 0.1
51 0.1
52 0.1
53 0.12
54 0.15
55 0.16
56 0.22
57 0.22
58 0.21
59 0.21
60 0.2
61 0.19
62 0.15
63 0.13
64 0.06
65 0.06
66 0.05
67 0.06
68 0.06
69 0.07
70 0.07
71 0.09
72 0.09
73 0.1
74 0.13
75 0.12
76 0.16
77 0.2
78 0.23
79 0.25