Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2WTW7

Protein Details
Accession V2WTW7    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
49-71GEKEHRRSKKAYKLTNKNRYEPQBasic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
KEGG mrr:Moror_11532  -  
Amino Acid Sequences MKKNPEGEIMQSAIKKCFTMVNYKTHALGHYMRSIKYYGTTDLTSSSSGEKEHRRSKKAYKLTNKNRYEPQIGNKVMCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.19
4 0.21
5 0.19
6 0.27
7 0.28
8 0.33
9 0.37
10 0.38
11 0.38
12 0.34
13 0.33
14 0.26
15 0.26
16 0.21
17 0.23
18 0.24
19 0.23
20 0.24
21 0.23
22 0.2
23 0.19
24 0.18
25 0.14
26 0.14
27 0.14
28 0.13
29 0.14
30 0.15
31 0.13
32 0.12
33 0.11
34 0.09
35 0.1
36 0.15
37 0.2
38 0.27
39 0.36
40 0.43
41 0.47
42 0.53
43 0.61
44 0.67
45 0.7
46 0.73
47 0.74
48 0.78
49 0.85
50 0.89
51 0.85
52 0.81
53 0.8
54 0.76
55 0.72
56 0.66
57 0.63
58 0.63
59 0.6