Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2Z2F8

Protein Details
Accession V2Z2F8    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPADRHSRSRLGRREPRMPSBasic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
KEGG mrr:Moror_380  -  
Amino Acid Sequences MPADRHSRSRLGRREPRMPSISGVLDDATPNSHLEPRSWPSAVLRYSPYYRYRWVPLRSSEDYDILTDNRVYFATPITTYYQLVDDSPLEGAEWSTTDIQTNINFDDDPPPPTPTIEADVDLAQQEQEPQLRVHVVQLATEKLSALARRIRNAFRIGRPNGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.78
4 0.72
5 0.64
6 0.56
7 0.5
8 0.43
9 0.34
10 0.29
11 0.21
12 0.17
13 0.16
14 0.14
15 0.11
16 0.1
17 0.1
18 0.11
19 0.14
20 0.14
21 0.15
22 0.21
23 0.23
24 0.27
25 0.27
26 0.26
27 0.26
28 0.32
29 0.31
30 0.28
31 0.27
32 0.27
33 0.29
34 0.33
35 0.35
36 0.31
37 0.33
38 0.34
39 0.38
40 0.42
41 0.44
42 0.44
43 0.46
44 0.5
45 0.49
46 0.49
47 0.44
48 0.37
49 0.33
50 0.28
51 0.24
52 0.17
53 0.14
54 0.11
55 0.09
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.09
64 0.1
65 0.11
66 0.11
67 0.11
68 0.12
69 0.1
70 0.1
71 0.09
72 0.07
73 0.07
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.05
82 0.06
83 0.06
84 0.06
85 0.07
86 0.08
87 0.09
88 0.1
89 0.09
90 0.09
91 0.09
92 0.1
93 0.14
94 0.14
95 0.16
96 0.17
97 0.18
98 0.18
99 0.18
100 0.19
101 0.16
102 0.19
103 0.16
104 0.15
105 0.14
106 0.14
107 0.14
108 0.14
109 0.12
110 0.08
111 0.07
112 0.08
113 0.08
114 0.1
115 0.12
116 0.12
117 0.13
118 0.15
119 0.15
120 0.16
121 0.18
122 0.16
123 0.17
124 0.19
125 0.19
126 0.19
127 0.19
128 0.17
129 0.13
130 0.17
131 0.16
132 0.18
133 0.24
134 0.27
135 0.34
136 0.4
137 0.43
138 0.45
139 0.51
140 0.54
141 0.55
142 0.61