Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2XUZ5

Protein Details
Accession V2XUZ5   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
139-158AGSPKWKKFRRSVDDISRVLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 10, nucl 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011012  Longin-like_dom_sf  
IPR006722  Sedlin  
IPR044760  TRAPPC2L  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
KEGG mrr:Moror_17459  -  
Pfam View protein in Pfam  
PF04628  Sedlin_N  
CDD cd14854  TRAPPC2L  
Amino Acid Sequences MAPNLRLNAVAFISPQNEPILIRTFSKQDETAIKYHYIAHTSLDVIEERVAANAKSSECYLGLLYAMEDAAVYGYITPLKVKIIIALALSDTVVRDLEINMIFKALHMAYYSAIGNPFITLQASADTFHDSSRSHILLAGSPKWKKFRRSVDDISRVLGNSPPIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.15
4 0.14
5 0.14
6 0.16
7 0.19
8 0.18
9 0.2
10 0.21
11 0.23
12 0.25
13 0.28
14 0.26
15 0.24
16 0.3
17 0.31
18 0.31
19 0.31
20 0.3
21 0.27
22 0.29
23 0.27
24 0.22
25 0.19
26 0.18
27 0.16
28 0.15
29 0.15
30 0.13
31 0.11
32 0.1
33 0.1
34 0.08
35 0.07
36 0.08
37 0.09
38 0.07
39 0.08
40 0.1
41 0.1
42 0.1
43 0.11
44 0.11
45 0.1
46 0.11
47 0.1
48 0.08
49 0.08
50 0.06
51 0.06
52 0.05
53 0.05
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.02
60 0.02
61 0.03
62 0.03
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.07
85 0.08
86 0.09
87 0.08
88 0.09
89 0.08
90 0.08
91 0.1
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.09
98 0.09
99 0.08
100 0.08
101 0.08
102 0.08
103 0.07
104 0.07
105 0.06
106 0.06
107 0.06
108 0.06
109 0.07
110 0.07
111 0.08
112 0.09
113 0.11
114 0.11
115 0.11
116 0.13
117 0.12
118 0.15
119 0.2
120 0.19
121 0.16
122 0.18
123 0.19
124 0.21
125 0.26
126 0.28
127 0.31
128 0.33
129 0.38
130 0.45
131 0.51
132 0.54
133 0.6
134 0.65
135 0.66
136 0.72
137 0.77
138 0.79
139 0.81
140 0.74
141 0.67
142 0.58
143 0.49
144 0.41
145 0.34