Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WP02

Protein Details
Accession V2WP02    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-47DAQEKKKTPKGRAKKRILYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
23-38AQEKKKTPKGRAKKRI
Subcellular Location(s) mito 12, cyto 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mrr:Moror_15037  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVDAQEKKKTPKGRAKKRILYNRRFVNVTTLPGGKRKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.45
4 0.44
5 0.45
6 0.51
7 0.5
8 0.55
9 0.55
10 0.56
11 0.58
12 0.6
13 0.63
14 0.63
15 0.64
16 0.63
17 0.68
18 0.71
19 0.72
20 0.77
21 0.8
22 0.82
23 0.86
24 0.89
25 0.89
26 0.86
27 0.84
28 0.81
29 0.75
30 0.68
31 0.58
32 0.56
33 0.48
34 0.43
35 0.38
36 0.33
37 0.31