Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2XYJ9

Protein Details
Accession V2XYJ9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRRRDKLKANSKSRRFKAGNBasic
NLS Segment(s)
PositionSequence
4-17RDKLKANSKSRRFK
Subcellular Location(s) nucl 17.5, mito_nucl 12.833, cyto_nucl 10.666, mito 6
Family & Domain DBs
KEGG mrr:Moror_17595  -  
Amino Acid Sequences MRRRDKLKANSKSRRFKAGNSEYKWKRVDNDNEKDLIVCSQFFSRGILSVSQCVDSRGETVVTWTHDSSMLVVSRKVEAHLDRVVVTCFLNIWAIHMGNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.76
3 0.71
4 0.72
5 0.72
6 0.71
7 0.66
8 0.72
9 0.65
10 0.69
11 0.66
12 0.56
13 0.5
14 0.5
15 0.55
16 0.54
17 0.58
18 0.54
19 0.52
20 0.51
21 0.46
22 0.37
23 0.28
24 0.18
25 0.11
26 0.09
27 0.09
28 0.09
29 0.09
30 0.1
31 0.09
32 0.09
33 0.09
34 0.1
35 0.1
36 0.11
37 0.11
38 0.12
39 0.11
40 0.11
41 0.11
42 0.09
43 0.1
44 0.09
45 0.09
46 0.07
47 0.09
48 0.1
49 0.12
50 0.13
51 0.12
52 0.12
53 0.13
54 0.13
55 0.12
56 0.13
57 0.13
58 0.12
59 0.13
60 0.13
61 0.14
62 0.15
63 0.15
64 0.17
65 0.16
66 0.2
67 0.21
68 0.21
69 0.2
70 0.21
71 0.21
72 0.17
73 0.16
74 0.12
75 0.1
76 0.1
77 0.12
78 0.1
79 0.12
80 0.15