Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2X722

Protein Details
Accession V2X722   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-98ATISSRSHSRRKQERICSQVVRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, nucl 9, cyto_mito 8.5, mito 6.5
Family & Domain DBs
KEGG mrr:Moror_8695  -  
Amino Acid Sequences MPHFHVLAILTSMFKDYSAPGVAGGAACNGSNPSSDNSRAARRALNYCRRNLKLSVPDQDGDRVGESRWSMPAIVLATISSRSHSRRKQERICSQVVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.11
5 0.12
6 0.12
7 0.11
8 0.11
9 0.11
10 0.1
11 0.09
12 0.06
13 0.05
14 0.05
15 0.05
16 0.06
17 0.06
18 0.06
19 0.08
20 0.1
21 0.13
22 0.14
23 0.17
24 0.2
25 0.24
26 0.25
27 0.25
28 0.26
29 0.25
30 0.32
31 0.37
32 0.44
33 0.43
34 0.47
35 0.53
36 0.52
37 0.52
38 0.46
39 0.44
40 0.41
41 0.42
42 0.42
43 0.37
44 0.36
45 0.34
46 0.33
47 0.28
48 0.21
49 0.18
50 0.12
51 0.1
52 0.12
53 0.12
54 0.12
55 0.12
56 0.12
57 0.11
58 0.1
59 0.13
60 0.11
61 0.1
62 0.09
63 0.08
64 0.09
65 0.11
66 0.11
67 0.1
68 0.14
69 0.19
70 0.28
71 0.36
72 0.46
73 0.54
74 0.65
75 0.73
76 0.8
77 0.85
78 0.83