Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WSM7

Protein Details
Accession V2WSM7   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-32GHERFPPCAHSHRRPRHRLPKAAQAAPBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019166  MIC26/MIC27  
IPR033181  Mic26_fungi  
Gene Ontology GO:0061617  C:MICOS complex  
GO:0042407  P:cristae formation  
KEGG mrr:Moror_6090  -  
Pfam View protein in Pfam  
PF09769  ApoO  
Amino Acid Sequences MQCLLGHERFPPCAHSHRRPRHRLPKAAQAAPLLASGIAATLSTPLDREKLPIYSQSDIEILVQQVFSELERQIDRVKAIISPEESLTPEILYVGVATLSGSILARNRALPLRILLPPVLLALNANHFLSKTSCDLASYLLDLEDTYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.5
3 0.58
4 0.66
5 0.76
6 0.82
7 0.88
8 0.9
9 0.91
10 0.9
11 0.85
12 0.85
13 0.83
14 0.76
15 0.68
16 0.57
17 0.48
18 0.39
19 0.33
20 0.22
21 0.14
22 0.1
23 0.07
24 0.06
25 0.04
26 0.03
27 0.03
28 0.04
29 0.04
30 0.04
31 0.05
32 0.06
33 0.08
34 0.08
35 0.11
36 0.12
37 0.14
38 0.15
39 0.2
40 0.23
41 0.22
42 0.23
43 0.22
44 0.2
45 0.18
46 0.17
47 0.13
48 0.09
49 0.08
50 0.07
51 0.06
52 0.06
53 0.06
54 0.05
55 0.06
56 0.06
57 0.08
58 0.08
59 0.09
60 0.1
61 0.11
62 0.11
63 0.1
64 0.1
65 0.09
66 0.1
67 0.11
68 0.11
69 0.11
70 0.11
71 0.11
72 0.12
73 0.11
74 0.11
75 0.09
76 0.07
77 0.06
78 0.06
79 0.05
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.06
91 0.08
92 0.09
93 0.09
94 0.12
95 0.14
96 0.15
97 0.15
98 0.16
99 0.18
100 0.19
101 0.2
102 0.18
103 0.16
104 0.15
105 0.14
106 0.12
107 0.09
108 0.08
109 0.07
110 0.11
111 0.12
112 0.12
113 0.11
114 0.11
115 0.13
116 0.14
117 0.16
118 0.16
119 0.17
120 0.17
121 0.17
122 0.18
123 0.18
124 0.18
125 0.16
126 0.13
127 0.11
128 0.11