Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2WL94

Protein Details
Accession V2WL94    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
123-142LPGYCRDRRRSMRTARRNYTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 7, cyto_nucl 6.5, nucl 5.5, cyto 4.5
Family & Domain DBs
KEGG mrr:Moror_12205  -  
Amino Acid Sequences MSTSHELAPSTASTTKPSSSTFQRARLSPELLNPICLPSPVIPINPDTQRPYRISVGRRGRGAGRHGFANRLDVRRSYNAYYGAARQSPGGVECPVCKLGVHCTVDCVDYVCPVCNTAKAGHLPGYCRDRRRSMRTARRNYTGGTSTLDHNWRDDTTWDDPDYGNGEQCKTSRSTIGRWNHRQYGFPRGTKNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.25
4 0.27
5 0.29
6 0.33
7 0.42
8 0.44
9 0.5
10 0.53
11 0.52
12 0.56
13 0.56
14 0.53
15 0.45
16 0.44
17 0.45
18 0.4
19 0.4
20 0.33
21 0.3
22 0.26
23 0.24
24 0.21
25 0.13
26 0.19
27 0.18
28 0.18
29 0.17
30 0.19
31 0.24
32 0.25
33 0.27
34 0.27
35 0.29
36 0.33
37 0.34
38 0.36
39 0.37
40 0.4
41 0.41
42 0.46
43 0.52
44 0.52
45 0.51
46 0.48
47 0.45
48 0.44
49 0.45
50 0.41
51 0.33
52 0.33
53 0.32
54 0.33
55 0.3
56 0.32
57 0.31
58 0.27
59 0.27
60 0.24
61 0.28
62 0.28
63 0.31
64 0.26
65 0.25
66 0.24
67 0.24
68 0.24
69 0.22
70 0.21
71 0.18
72 0.16
73 0.13
74 0.12
75 0.11
76 0.1
77 0.1
78 0.08
79 0.08
80 0.08
81 0.1
82 0.1
83 0.1
84 0.09
85 0.08
86 0.12
87 0.18
88 0.19
89 0.17
90 0.18
91 0.19
92 0.19
93 0.18
94 0.16
95 0.09
96 0.09
97 0.09
98 0.09
99 0.08
100 0.09
101 0.1
102 0.1
103 0.11
104 0.11
105 0.13
106 0.13
107 0.15
108 0.18
109 0.19
110 0.2
111 0.24
112 0.31
113 0.32
114 0.36
115 0.39
116 0.44
117 0.51
118 0.57
119 0.61
120 0.64
121 0.71
122 0.77
123 0.83
124 0.79
125 0.77
126 0.7
127 0.62
128 0.57
129 0.48
130 0.39
131 0.32
132 0.27
133 0.23
134 0.27
135 0.29
136 0.24
137 0.23
138 0.24
139 0.21
140 0.22
141 0.21
142 0.21
143 0.22
144 0.26
145 0.25
146 0.24
147 0.23
148 0.24
149 0.26
150 0.22
151 0.21
152 0.18
153 0.19
154 0.2
155 0.21
156 0.22
157 0.21
158 0.22
159 0.26
160 0.28
161 0.33
162 0.39
163 0.49
164 0.57
165 0.63
166 0.7
167 0.71
168 0.7
169 0.7
170 0.65
171 0.66
172 0.63
173 0.59