Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2YVS0

Protein Details
Accession V2YVS0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGRSAKVHKRVQKKNKTSISSFHydrophilic
NLS Segment(s)
PositionSequence
41-52KKKANLKEKAKA
Subcellular Location(s) mito 25
Family & Domain DBs
KEGG mrr:Moror_12396  -  
Amino Acid Sequences MGRSAKVHKRVQKKNKTSISSFSTPAASNAPSQAQHLHVAKKKANLKEKAKATATASQSKRKEGGRVLGDVDYVSLMMGGRRKAKEEAAKLAAMEVEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.85
4 0.78
5 0.74
6 0.7
7 0.63
8 0.55
9 0.45
10 0.38
11 0.32
12 0.29
13 0.25
14 0.18
15 0.15
16 0.15
17 0.16
18 0.14
19 0.15
20 0.15
21 0.15
22 0.18
23 0.2
24 0.25
25 0.27
26 0.32
27 0.33
28 0.38
29 0.43
30 0.46
31 0.52
32 0.54
33 0.56
34 0.59
35 0.6
36 0.58
37 0.53
38 0.47
39 0.42
40 0.39
41 0.37
42 0.38
43 0.37
44 0.41
45 0.41
46 0.41
47 0.42
48 0.37
49 0.38
50 0.33
51 0.38
52 0.32
53 0.33
54 0.32
55 0.28
56 0.27
57 0.22
58 0.18
59 0.1
60 0.08
61 0.06
62 0.04
63 0.04
64 0.06
65 0.09
66 0.12
67 0.19
68 0.2
69 0.24
70 0.27
71 0.34
72 0.42
73 0.44
74 0.49
75 0.46
76 0.46
77 0.42
78 0.4