Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2W3V6

Protein Details
Accession V2W3V6    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
99-119DHNGEKKSKKKTGYKARREELBasic
NLS Segment(s)
PositionSequence
79-116EWKLQRPGARRSHKGPQPEKDHNGEKKSKKKTGYKARR
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
KEGG mrr:Moror_2194  -  
Amino Acid Sequences MDLDAVVDLVEESPEMECEDKDKEYELPGTEDSVVIKYRLDRLNQPQLLALHRDLGFGTKGKKEDFLRKLKDYSTKPEEWKLQRPGARRSHKGPQPEKDHNGEKKSKKKTGYKARREELIKDQPLESVQRSHDTCLLKTKQELLEWAGDCPAVSHKTNDPRAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.08
4 0.08
5 0.11
6 0.14
7 0.15
8 0.15
9 0.17
10 0.17
11 0.18
12 0.22
13 0.21
14 0.21
15 0.2
16 0.21
17 0.19
18 0.18
19 0.16
20 0.15
21 0.14
22 0.11
23 0.12
24 0.12
25 0.18
26 0.22
27 0.24
28 0.29
29 0.36
30 0.46
31 0.46
32 0.45
33 0.41
34 0.39
35 0.38
36 0.34
37 0.26
38 0.2
39 0.19
40 0.19
41 0.16
42 0.16
43 0.16
44 0.14
45 0.17
46 0.15
47 0.17
48 0.17
49 0.23
50 0.25
51 0.34
52 0.39
53 0.46
54 0.48
55 0.49
56 0.51
57 0.48
58 0.52
59 0.45
60 0.46
61 0.43
62 0.42
63 0.41
64 0.44
65 0.48
66 0.45
67 0.5
68 0.47
69 0.46
70 0.45
71 0.48
72 0.51
73 0.54
74 0.57
75 0.53
76 0.53
77 0.56
78 0.57
79 0.62
80 0.6
81 0.59
82 0.6
83 0.63
84 0.63
85 0.59
86 0.64
87 0.59
88 0.59
89 0.6
90 0.59
91 0.61
92 0.66
93 0.67
94 0.66
95 0.7
96 0.74
97 0.77
98 0.8
99 0.81
100 0.82
101 0.79
102 0.79
103 0.72
104 0.67
105 0.65
106 0.63
107 0.56
108 0.48
109 0.45
110 0.38
111 0.37
112 0.36
113 0.28
114 0.22
115 0.2
116 0.25
117 0.26
118 0.27
119 0.31
120 0.3
121 0.3
122 0.36
123 0.37
124 0.34
125 0.35
126 0.39
127 0.37
128 0.36
129 0.37
130 0.3
131 0.34
132 0.32
133 0.3
134 0.25
135 0.21
136 0.19
137 0.18
138 0.2
139 0.17
140 0.18
141 0.21
142 0.28
143 0.38