Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2X3B1

Protein Details
Accession V2X3B1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21PLFSRRTHRTTRTTRSHRGGHydrophilic
NLS Segment(s)
PositionSequence
50-56RKHAKHK
Subcellular Location(s) nucl 16.5, mito_nucl 12.166, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
KEGG mrr:Moror_1614  -  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MPLFSRRTHRTTRTTRSHRGGGLFHRKDRDRVAGGYKAALSNPNTTREGRKHAKHKLRSMGQSTHVPFMTKVKRTLGIRSGPRHSRTTKRTRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.79
4 0.76
5 0.69
6 0.62
7 0.57
8 0.56
9 0.58
10 0.54
11 0.51
12 0.53
13 0.52
14 0.52
15 0.52
16 0.48
17 0.4
18 0.38
19 0.39
20 0.35
21 0.34
22 0.31
23 0.27
24 0.21
25 0.18
26 0.18
27 0.15
28 0.17
29 0.19
30 0.21
31 0.23
32 0.24
33 0.28
34 0.27
35 0.34
36 0.35
37 0.4
38 0.45
39 0.54
40 0.62
41 0.65
42 0.7
43 0.71
44 0.71
45 0.7
46 0.67
47 0.61
48 0.55
49 0.54
50 0.49
51 0.43
52 0.37
53 0.31
54 0.27
55 0.31
56 0.35
57 0.32
58 0.33
59 0.33
60 0.39
61 0.4
62 0.47
63 0.45
64 0.46
65 0.5
66 0.54
67 0.59
68 0.6
69 0.63
70 0.63
71 0.63
72 0.65
73 0.67