Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2WVR3

Protein Details
Accession V2WVR3    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
25-61ANNNEKKDDDKKKNDNEKKNDDKKKDNDKKNDDEEKEAcidic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12.333, cyto 5.5, cyto_pero 5.166, pero 3.5
Family & Domain DBs
KEGG mrr:Moror_9960  -  
Amino Acid Sequences MDINQINDDGILNGQVDEEVVAMDANNNEKKDDDKKKNDNEKKNDDKKKDNDKKNDDEEKEKDADDEDAAMYRVEEEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.03
10 0.05
11 0.05
12 0.09
13 0.12
14 0.13
15 0.13
16 0.14
17 0.17
18 0.26
19 0.35
20 0.41
21 0.47
22 0.55
23 0.65
24 0.75
25 0.81
26 0.81
27 0.78
28 0.79
29 0.8
30 0.82
31 0.81
32 0.76
33 0.76
34 0.75
35 0.79
36 0.8
37 0.79
38 0.79
39 0.78
40 0.79
41 0.8
42 0.8
43 0.72
44 0.7
45 0.64
46 0.58
47 0.52
48 0.45
49 0.36
50 0.28
51 0.25
52 0.18
53 0.16
54 0.12
55 0.11
56 0.11
57 0.11
58 0.09