Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2WKA4

Protein Details
Accession V2WKA4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-76LVMANRKKREPIKPKIVRKEKEVTHydrophilic
NLS Segment(s)
PositionSequence
58-73RKKREPIKPKIVRKEK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
KEGG mrr:Moror_13442  -  
Amino Acid Sequences MDTKYDDEALMRFFREGLPESLQNKIMLRTDGEPETLDKWYKLAIMYDNQYKLVMANRKKREPIKPKIVRKEKEVTVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.18
4 0.18
5 0.2
6 0.25
7 0.26
8 0.28
9 0.29
10 0.27
11 0.25
12 0.23
13 0.21
14 0.16
15 0.17
16 0.16
17 0.17
18 0.17
19 0.17
20 0.15
21 0.14
22 0.15
23 0.15
24 0.14
25 0.1
26 0.1
27 0.1
28 0.1
29 0.09
30 0.08
31 0.09
32 0.11
33 0.15
34 0.19
35 0.19
36 0.19
37 0.18
38 0.17
39 0.16
40 0.2
41 0.25
42 0.29
43 0.38
44 0.46
45 0.52
46 0.6
47 0.66
48 0.71
49 0.72
50 0.75
51 0.76
52 0.79
53 0.83
54 0.87
55 0.9
56 0.84
57 0.81
58 0.79