Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2XA71

Protein Details
Accession V2XA71    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
57-81MELLRNSKDKKARKLTKKRLGTLLRHydrophilic
NLS Segment(s)
PositionSequence
63-85SKDKKARKLTKKRLGTLLRSKRK
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mrr:Moror_7443  -  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
Amino Acid Sequences MARSNLRVGLNKGHPITPIAKVQRPSQRKGIQSTKTKFVRSVVREVAGFSAYERRVMELLRNSKDKKARKLTKKRLGTLLRSKRKIEELSSIIQESRRAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.35
4 0.3
5 0.33
6 0.32
7 0.35
8 0.36
9 0.43
10 0.5
11 0.53
12 0.53
13 0.56
14 0.57
15 0.56
16 0.62
17 0.63
18 0.62
19 0.66
20 0.65
21 0.65
22 0.62
23 0.59
24 0.52
25 0.47
26 0.48
27 0.41
28 0.43
29 0.36
30 0.33
31 0.32
32 0.31
33 0.27
34 0.19
35 0.15
36 0.09
37 0.12
38 0.11
39 0.13
40 0.12
41 0.12
42 0.13
43 0.13
44 0.17
45 0.19
46 0.25
47 0.27
48 0.33
49 0.34
50 0.39
51 0.47
52 0.51
53 0.53
54 0.58
55 0.65
56 0.71
57 0.8
58 0.86
59 0.88
60 0.89
61 0.84
62 0.82
63 0.79
64 0.77
65 0.76
66 0.76
67 0.76
68 0.73
69 0.7
70 0.65
71 0.65
72 0.61
73 0.54
74 0.51
75 0.45
76 0.44
77 0.45
78 0.42
79 0.36
80 0.33
81 0.31