Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WMS6

Protein Details
Accession V2WMS6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
220-239DDEHGGKKPQRSFRKKEEVABasic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 14, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032567  LDOC1-rel  
IPR005162  Retrotrans_gag_dom  
KEGG mrr:Moror_15661  -  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
Amino Acid Sequences MAEDKKPSGSRPRREEPVAEEAVIGSAMPVQVVSAVKEVKAALPRAFTGARKDAKKFLREVLIYVALNPKAFPDDRSKKLFLLSYMTDGPGEFWKNEKTDLLLAFDANAEKVTWSEFLDDFRTSFEPLDPALKAQLELKDLKMKERADEYTYQFTYLAKQTGYNDAAQIVAFKRGLPKSLVFKIMTRPEGAPSTIKEWMNAAIIFDESYKQALEYGKTWDDEHGGKKPQRSFRKKEEVAIKQITEIDSVTLLVRSNVKLLDYDVVKKLVRFKVQSLSQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.71
3 0.66
4 0.65
5 0.57
6 0.48
7 0.39
8 0.31
9 0.27
10 0.22
11 0.16
12 0.07
13 0.06
14 0.05
15 0.05
16 0.05
17 0.04
18 0.07
19 0.08
20 0.09
21 0.12
22 0.13
23 0.13
24 0.14
25 0.15
26 0.16
27 0.21
28 0.23
29 0.21
30 0.23
31 0.23
32 0.26
33 0.28
34 0.26
35 0.28
36 0.32
37 0.38
38 0.4
39 0.43
40 0.47
41 0.52
42 0.54
43 0.5
44 0.47
45 0.48
46 0.44
47 0.43
48 0.39
49 0.36
50 0.31
51 0.3
52 0.29
53 0.22
54 0.22
55 0.2
56 0.16
57 0.15
58 0.16
59 0.18
60 0.24
61 0.31
62 0.36
63 0.43
64 0.44
65 0.41
66 0.43
67 0.42
68 0.33
69 0.3
70 0.26
71 0.23
72 0.22
73 0.22
74 0.19
75 0.17
76 0.17
77 0.14
78 0.15
79 0.12
80 0.13
81 0.16
82 0.17
83 0.18
84 0.17
85 0.16
86 0.17
87 0.18
88 0.18
89 0.15
90 0.14
91 0.13
92 0.13
93 0.11
94 0.08
95 0.08
96 0.05
97 0.05
98 0.05
99 0.06
100 0.06
101 0.07
102 0.09
103 0.09
104 0.1
105 0.13
106 0.13
107 0.12
108 0.13
109 0.13
110 0.12
111 0.12
112 0.11
113 0.09
114 0.1
115 0.11
116 0.1
117 0.09
118 0.09
119 0.09
120 0.09
121 0.1
122 0.11
123 0.11
124 0.12
125 0.13
126 0.18
127 0.18
128 0.2
129 0.23
130 0.22
131 0.22
132 0.24
133 0.25
134 0.22
135 0.26
136 0.27
137 0.27
138 0.27
139 0.26
140 0.23
141 0.21
142 0.21
143 0.18
144 0.16
145 0.11
146 0.12
147 0.13
148 0.18
149 0.19
150 0.17
151 0.15
152 0.14
153 0.14
154 0.12
155 0.12
156 0.08
157 0.09
158 0.09
159 0.09
160 0.14
161 0.15
162 0.17
163 0.18
164 0.2
165 0.24
166 0.27
167 0.31
168 0.27
169 0.27
170 0.33
171 0.36
172 0.34
173 0.3
174 0.27
175 0.26
176 0.27
177 0.27
178 0.22
179 0.18
180 0.21
181 0.24
182 0.23
183 0.21
184 0.2
185 0.2
186 0.2
187 0.19
188 0.15
189 0.1
190 0.1
191 0.1
192 0.1
193 0.09
194 0.07
195 0.08
196 0.08
197 0.07
198 0.1
199 0.11
200 0.13
201 0.14
202 0.18
203 0.2
204 0.21
205 0.22
206 0.2
207 0.21
208 0.23
209 0.26
210 0.27
211 0.33
212 0.35
213 0.41
214 0.48
215 0.55
216 0.63
217 0.69
218 0.71
219 0.73
220 0.81
221 0.77
222 0.77
223 0.78
224 0.74
225 0.73
226 0.7
227 0.59
228 0.5
229 0.49
230 0.41
231 0.32
232 0.25
233 0.17
234 0.12
235 0.12
236 0.11
237 0.1
238 0.09
239 0.1
240 0.13
241 0.13
242 0.15
243 0.15
244 0.15
245 0.15
246 0.17
247 0.21
248 0.21
249 0.25
250 0.25
251 0.29
252 0.29
253 0.3
254 0.37
255 0.39
256 0.44
257 0.43
258 0.45
259 0.5