Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WKT6

Protein Details
Accession V2WKT6   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-48IQDARARTVNHRRTRRTRTITQDPYFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 9, cyto 7, mito 3.5
Family & Domain DBs
KEGG mrr:Moror_6020  -  
Amino Acid Sequences MGIIYQTINNGNGNRTSNGTVIIQDARARTVNHRRTRRTRTITQDPYFRRTQIVYGTYDNGDWNMTVNGCILSNDPTFTDVAWVDYDNQSPTELSTEFDTRQQGKRNTVLNACYDNGTLTLADRRRRDWYFNAENNGRKNKIWNNCNCSGSNPIETSPSGNFEDLGMQFFWVNPRGRTFVGSPSWERSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.28
4 0.25
5 0.26
6 0.24
7 0.2
8 0.19
9 0.19
10 0.17
11 0.17
12 0.17
13 0.18
14 0.2
15 0.21
16 0.27
17 0.36
18 0.45
19 0.52
20 0.61
21 0.68
22 0.75
23 0.83
24 0.85
25 0.83
26 0.82
27 0.81
28 0.83
29 0.83
30 0.77
31 0.76
32 0.7
33 0.67
34 0.6
35 0.52
36 0.43
37 0.34
38 0.32
39 0.29
40 0.28
41 0.25
42 0.25
43 0.26
44 0.24
45 0.23
46 0.21
47 0.15
48 0.13
49 0.09
50 0.09
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.09
60 0.1
61 0.1
62 0.1
63 0.1
64 0.1
65 0.1
66 0.1
67 0.07
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.1
74 0.09
75 0.1
76 0.09
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.09
83 0.1
84 0.11
85 0.13
86 0.16
87 0.17
88 0.21
89 0.28
90 0.29
91 0.31
92 0.36
93 0.37
94 0.37
95 0.37
96 0.35
97 0.3
98 0.29
99 0.26
100 0.21
101 0.18
102 0.15
103 0.12
104 0.11
105 0.08
106 0.07
107 0.12
108 0.16
109 0.21
110 0.23
111 0.25
112 0.32
113 0.34
114 0.39
115 0.39
116 0.44
117 0.48
118 0.51
119 0.55
120 0.53
121 0.56
122 0.57
123 0.58
124 0.51
125 0.42
126 0.45
127 0.46
128 0.5
129 0.55
130 0.57
131 0.58
132 0.62
133 0.65
134 0.58
135 0.53
136 0.49
137 0.43
138 0.38
139 0.31
140 0.26
141 0.26
142 0.25
143 0.25
144 0.21
145 0.21
146 0.19
147 0.18
148 0.18
149 0.15
150 0.19
151 0.16
152 0.18
153 0.14
154 0.12
155 0.12
156 0.13
157 0.16
158 0.18
159 0.21
160 0.21
161 0.25
162 0.28
163 0.29
164 0.33
165 0.32
166 0.33
167 0.36
168 0.39
169 0.39
170 0.41