Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2YVU0

Protein Details
Accession V2YVU0    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
179-198GSPFRDKRYCRKELARKVAVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 13.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020845  AMP-binding_CS  
IPR000873  AMP-dep_Synth/Lig_com  
IPR042099  ANL_N_sf  
Gene Ontology GO:0016874  F:ligase activity  
KEGG mrr:Moror_12421  -  
Pfam View protein in Pfam  
PF00501  AMP-binding  
PROSITE View protein in PROSITE  
PS00455  AMP_BINDING  
Amino Acid Sequences MAHLPLPIPQGTKVPPLSIPDDLTLPQFILEANHPHRPKVSSAHPSLIEERTGRSIPIEELRARTDALANGLSELGIGDNDVVLLSSPNHVDYPIIIWAVHRLGAIVTLSNPNFTEEELSSHIRLTKPRIIIAHLSSFQTAHTCAARAPPTLKPIQVLGMEHSFDGTPSISDLIEVNMGSPFRDKRYCRKELARKVAVLCLSSGTTGQPKVEVVFYPVRPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.31
4 0.34
5 0.32
6 0.31
7 0.25
8 0.26
9 0.24
10 0.23
11 0.2
12 0.15
13 0.13
14 0.11
15 0.09
16 0.1
17 0.12
18 0.19
19 0.22
20 0.31
21 0.32
22 0.33
23 0.36
24 0.36
25 0.37
26 0.36
27 0.4
28 0.4
29 0.44
30 0.47
31 0.45
32 0.46
33 0.46
34 0.41
35 0.34
36 0.26
37 0.24
38 0.23
39 0.23
40 0.2
41 0.17
42 0.17
43 0.17
44 0.2
45 0.22
46 0.2
47 0.22
48 0.23
49 0.23
50 0.22
51 0.2
52 0.18
53 0.14
54 0.15
55 0.13
56 0.11
57 0.11
58 0.1
59 0.09
60 0.07
61 0.07
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.04
73 0.05
74 0.05
75 0.06
76 0.06
77 0.07
78 0.07
79 0.06
80 0.08
81 0.08
82 0.08
83 0.07
84 0.07
85 0.08
86 0.08
87 0.09
88 0.07
89 0.06
90 0.05
91 0.06
92 0.06
93 0.05
94 0.05
95 0.07
96 0.07
97 0.08
98 0.08
99 0.09
100 0.09
101 0.09
102 0.11
103 0.08
104 0.1
105 0.13
106 0.14
107 0.13
108 0.13
109 0.16
110 0.15
111 0.17
112 0.2
113 0.23
114 0.22
115 0.25
116 0.25
117 0.25
118 0.27
119 0.27
120 0.26
121 0.22
122 0.21
123 0.19
124 0.18
125 0.16
126 0.14
127 0.12
128 0.1
129 0.09
130 0.09
131 0.09
132 0.14
133 0.16
134 0.16
135 0.18
136 0.2
137 0.24
138 0.26
139 0.26
140 0.22
141 0.21
142 0.22
143 0.21
144 0.19
145 0.17
146 0.17
147 0.17
148 0.16
149 0.16
150 0.12
151 0.11
152 0.11
153 0.08
154 0.06
155 0.06
156 0.08
157 0.07
158 0.07
159 0.07
160 0.07
161 0.08
162 0.08
163 0.07
164 0.08
165 0.09
166 0.09
167 0.13
168 0.14
169 0.19
170 0.27
171 0.31
172 0.4
173 0.49
174 0.56
175 0.6
176 0.69
177 0.74
178 0.77
179 0.83
180 0.78
181 0.73
182 0.68
183 0.65
184 0.56
185 0.46
186 0.36
187 0.27
188 0.22
189 0.18
190 0.17
191 0.14
192 0.16
193 0.17
194 0.17
195 0.17
196 0.17
197 0.18
198 0.2
199 0.18
200 0.19
201 0.25
202 0.26