Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2YJM6

Protein Details
Accession V2YJM6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-34IQRVKAKISQIKDRKNRKKKGEDKNPITIQHydrophilic
NLS Segment(s)
PositionSequence
11-25KISQIKDRKNRKKKG
Subcellular Location(s) nucl 14, mito_nucl 13.833, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
KEGG mrr:Moror_10455  -  
Amino Acid Sequences MSTLIQRVKAKISQIKDRKNRKKKGEDKNPITIQPVPKEPSVVPAPFDVPGPVVPDPSQLEQPLSREELHARQEELNAKKPEQGSGPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.71
4 0.79
5 0.82
6 0.86
7 0.89
8 0.89
9 0.9
10 0.9
11 0.91
12 0.91
13 0.91
14 0.87
15 0.87
16 0.79
17 0.69
18 0.62
19 0.55
20 0.48
21 0.4
22 0.38
23 0.3
24 0.27
25 0.28
26 0.25
27 0.25
28 0.25
29 0.22
30 0.18
31 0.16
32 0.17
33 0.15
34 0.15
35 0.11
36 0.08
37 0.08
38 0.1
39 0.09
40 0.1
41 0.1
42 0.12
43 0.14
44 0.15
45 0.17
46 0.14
47 0.16
48 0.16
49 0.18
50 0.18
51 0.18
52 0.17
53 0.17
54 0.2
55 0.24
56 0.27
57 0.28
58 0.27
59 0.26
60 0.3
61 0.37
62 0.38
63 0.42
64 0.41
65 0.4
66 0.43
67 0.43
68 0.42