Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2WQG1

Protein Details
Accession V2WQG1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-32PSTAQQHHDHLKKRRRRHNQKHAAIAAVHydrophilic
NLS Segment(s)
PositionSequence
16-23KKRRRRHN
Subcellular Location(s) mito 11, nucl 9, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mrr:Moror_8549  -  
Amino Acid Sequences MVSTPSTAQQHHDHLKKRRRRHNQKHAAIAAVIGAVASLLPSIRHEESQPMRTSMLTGELWMHELLTGNERRFSEQLMKGLMDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.69
3 0.74
4 0.79
5 0.82
6 0.84
7 0.89
8 0.91
9 0.92
10 0.93
11 0.91
12 0.9
13 0.8
14 0.7
15 0.58
16 0.47
17 0.35
18 0.23
19 0.15
20 0.06
21 0.04
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.03
29 0.07
30 0.08
31 0.09
32 0.09
33 0.16
34 0.2
35 0.25
36 0.26
37 0.24
38 0.24
39 0.23
40 0.24
41 0.17
42 0.17
43 0.12
44 0.11
45 0.1
46 0.1
47 0.12
48 0.11
49 0.1
50 0.07
51 0.08
52 0.09
53 0.14
54 0.18
55 0.18
56 0.22
57 0.23
58 0.28
59 0.27
60 0.31
61 0.33
62 0.34
63 0.36
64 0.35