Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2X659

Protein Details
Accession V2X659    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
200-224ADARGELKQGKKRKRQISPEGDEMVHydrophilic
NLS Segment(s)
PositionSequence
58-65SKPKRIKK
208-214QGKKRKR
Subcellular Location(s) mito 22.5, mito_nucl 13, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
IPR014612  Pop7/Rpp20  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0003676  F:nucleic acid binding  
GO:0001682  P:tRNA 5'-leader removal  
KEGG mrr:Moror_1307  -  
Pfam View protein in Pfam  
PF12328  Rpp20  
Amino Acid Sequences MSSGSASGRAPKRLKLTSANGSVQAVPVSAQQSASTSAPTSAPQTTILTEKSTRSAGSKPKRIKKLVAPRPFPTVATADSATGPRSAHKEGKNYICLTRKTSLGAYMQRCKTLILKDGFRTLHLSAMGAAIPLLMHLACALPPILPYAPKDISTEILTGTTEVMDEITPEAEDEDISYQTRAKSTLRVTMKIYGGNQVAADARGELKQGKKRKRQISPEGDEMVVLEEPEQVEMEML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.57
4 0.57
5 0.61
6 0.57
7 0.51
8 0.47
9 0.42
10 0.35
11 0.27
12 0.19
13 0.13
14 0.13
15 0.13
16 0.12
17 0.12
18 0.11
19 0.12
20 0.15
21 0.15
22 0.13
23 0.13
24 0.13
25 0.14
26 0.14
27 0.16
28 0.14
29 0.15
30 0.16
31 0.16
32 0.17
33 0.19
34 0.19
35 0.19
36 0.2
37 0.2
38 0.21
39 0.21
40 0.21
41 0.2
42 0.26
43 0.32
44 0.4
45 0.48
46 0.55
47 0.64
48 0.72
49 0.73
50 0.73
51 0.73
52 0.75
53 0.75
54 0.76
55 0.72
56 0.65
57 0.68
58 0.62
59 0.52
60 0.43
61 0.35
62 0.26
63 0.23
64 0.21
65 0.15
66 0.15
67 0.15
68 0.14
69 0.13
70 0.12
71 0.1
72 0.14
73 0.17
74 0.23
75 0.27
76 0.32
77 0.36
78 0.41
79 0.44
80 0.42
81 0.43
82 0.43
83 0.4
84 0.39
85 0.36
86 0.31
87 0.28
88 0.27
89 0.24
90 0.22
91 0.27
92 0.27
93 0.33
94 0.33
95 0.32
96 0.31
97 0.29
98 0.28
99 0.24
100 0.26
101 0.22
102 0.24
103 0.24
104 0.29
105 0.28
106 0.26
107 0.26
108 0.19
109 0.18
110 0.15
111 0.14
112 0.1
113 0.1
114 0.09
115 0.06
116 0.05
117 0.03
118 0.03
119 0.03
120 0.03
121 0.02
122 0.02
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.04
129 0.04
130 0.06
131 0.07
132 0.08
133 0.09
134 0.14
135 0.15
136 0.16
137 0.17
138 0.16
139 0.18
140 0.18
141 0.17
142 0.12
143 0.12
144 0.1
145 0.09
146 0.08
147 0.06
148 0.05
149 0.04
150 0.05
151 0.04
152 0.04
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.06
162 0.07
163 0.08
164 0.09
165 0.1
166 0.11
167 0.12
168 0.14
169 0.14
170 0.19
171 0.21
172 0.3
173 0.32
174 0.34
175 0.36
176 0.4
177 0.41
178 0.38
179 0.36
180 0.32
181 0.29
182 0.26
183 0.23
184 0.18
185 0.17
186 0.14
187 0.14
188 0.09
189 0.1
190 0.09
191 0.11
192 0.15
193 0.21
194 0.3
195 0.39
196 0.49
197 0.58
198 0.68
199 0.77
200 0.83
201 0.86
202 0.88
203 0.89
204 0.86
205 0.82
206 0.76
207 0.65
208 0.54
209 0.44
210 0.35
211 0.25
212 0.17
213 0.11
214 0.09
215 0.09
216 0.1
217 0.1