Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2X1I0

Protein Details
Accession V2X1I0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
83-102YRKGIHKVPKWTRITQRTNPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG mrr:Moror_8896  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSHVNLGGLLWKVPWRLSATRKANARARLKKVDAVIEAVRASGVRCTALDRALELPKEHEMPARDKYTVFSPHARGYRKGIHKVPKWTRITQRTNPLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.14
4 0.15
5 0.16
6 0.16
7 0.16
8 0.18
9 0.24
10 0.29
11 0.39
12 0.43
13 0.48
14 0.52
15 0.56
16 0.58
17 0.61
18 0.65
19 0.64
20 0.64
21 0.66
22 0.63
23 0.6
24 0.55
25 0.49
26 0.4
27 0.34
28 0.28
29 0.21
30 0.19
31 0.15
32 0.13
33 0.1
34 0.09
35 0.06
36 0.06
37 0.05
38 0.05
39 0.07
40 0.08
41 0.1
42 0.09
43 0.1
44 0.12
45 0.14
46 0.15
47 0.13
48 0.14
49 0.14
50 0.16
51 0.15
52 0.16
53 0.16
54 0.2
55 0.25
56 0.26
57 0.24
58 0.23
59 0.25
60 0.27
61 0.3
62 0.29
63 0.29
64 0.3
65 0.36
66 0.42
67 0.44
68 0.41
69 0.42
70 0.48
71 0.51
72 0.56
73 0.57
74 0.61
75 0.64
76 0.73
77 0.76
78 0.76
79 0.75
80 0.75
81 0.78
82 0.78
83 0.8
84 0.78
85 0.79