Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WTW8

Protein Details
Accession V2WTW8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
86-112CQLKKGKPEPELKPKPKPKETQKESDSBasic
NLS Segment(s)
PositionSequence
89-104KKGKPEPELKPKPKPK
Subcellular Location(s) cyto_nucl 12.833, nucl 11.5, cyto 10, mito_nucl 9.332, mito 5.5
Family & Domain DBs
KEGG mrr:Moror_15726  -  
Amino Acid Sequences MGGHGCKKTKPMQYEQTKDSSLVTLSQQLPPNAPAAQDDGKTQLGGEEGSDVGADPPPACHLQQLVTPSGPPIPCMVVDILDPKLCQLKKGKPEPELKPKPKPKETQKESDSSNTKSSIEIKSAPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.7
3 0.67
4 0.6
5 0.53
6 0.45
7 0.36
8 0.26
9 0.21
10 0.18
11 0.19
12 0.2
13 0.24
14 0.27
15 0.26
16 0.27
17 0.26
18 0.27
19 0.21
20 0.2
21 0.15
22 0.16
23 0.17
24 0.16
25 0.16
26 0.17
27 0.17
28 0.16
29 0.15
30 0.11
31 0.09
32 0.09
33 0.08
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.05
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.09
50 0.11
51 0.13
52 0.12
53 0.11
54 0.11
55 0.11
56 0.13
57 0.12
58 0.11
59 0.1
60 0.09
61 0.09
62 0.1
63 0.1
64 0.07
65 0.08
66 0.1
67 0.1
68 0.1
69 0.1
70 0.09
71 0.16
72 0.15
73 0.19
74 0.24
75 0.31
76 0.4
77 0.5
78 0.55
79 0.56
80 0.65
81 0.7
82 0.74
83 0.77
84 0.75
85 0.76
86 0.8
87 0.82
88 0.83
89 0.84
90 0.84
91 0.84
92 0.84
93 0.84
94 0.79
95 0.74
96 0.7
97 0.69
98 0.64
99 0.56
100 0.53
101 0.45
102 0.4
103 0.37
104 0.38
105 0.32
106 0.31