FuNGI

V2YRU7

Protein Details

Accession

V2YRU7

Localization Confidence

Medium

Confidence Score

13.9

NoLS Segment(s)

Position	Sequence	Protein Nature
1-21	MGQHNSKYKNRQPQPYPLANP	Hydrophilic
50-81	ITPFPFNYYPQQTRRKKKRRRPSARLNTSVAG	Hydrophilic

NLS Segment(s)

Position	Sequence
63-73	RRKKKRRRPSA

Subcellular Location(s)

nucl 12.5, mito 11, cyto_nucl 8.5

Family & Domain DBs

InterPro	View protein in InterPro IPR012816 NADAR IPR037238 YbiA-like_sf
KEGG	mrr:Moror_8047 -
Pfam	View protein in Pfam PF08719 NADAR
CDD	cd15457 NADAR

Amino Acid Sequences

MGQHNSKYKNRQPQPYPLANPAFYPHNGAIYPAAYPHFATGPVVPQHHLITPFPFNYYPQQTRRKKKRRRPSARLNTSVAGPSSQPEPQPQAPQVTAAAGVPPPPAVQPVPPVANSVPFTPHMESLANFPRSPLQNPMAVNSRGPTPYPRNPEDDEEEDEEDEEEIVIPSRVRGLRTPAPHRRTRSLPRSGGDVSRSRTPQVEITAPVNPITPWPVSNNPLPQPPRDVTQDSPYRQLANLPEVQSIRRSASAAGASAERERLFRELLANQNPGRIASSQSEALHTQPQPQPSAHHRSRTVASLFGRKNGGGILRTLNPRRRHAHSNSINSDGYVNVQPAEIPRSTTPAEPPPPVMNYTSSVTSADGGPPPPVLNATATPVFAGTRSVTPGVPGVGTTTPGIATPAVGLTQPPQTTAPPPGQLFEPVQSQQSFTYPNTPATQHVYTRPTTPAAPPNLSAPPPIHFSQFSPAPYSGFLNHSPHRVMYQNRTYPTATHLFEALKFLPRHSEFATKISDTPSVPEVYRLSSSWQKHVRPDWGQVFLSMMEEVLMCKFRQHPDLRNVLLATGATDPTREIIYEDERDRFWGRAQDGQGRNVLGNALRTVRERLRVEFG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.84
2	0.83
3	0.79
4	0.77
5	0.73
6	0.63
7	0.57
8	0.5
9	0.45
10	0.36
11	0.37
12	0.29
13	0.26
14	0.26
15	0.26
16	0.25
17	0.2
18	0.2
19	0.16
20	0.16
21	0.14
22	0.14
23	0.14
24	0.14
25	0.13
26	0.15
27	0.14
28	0.2
29	0.23
30	0.25
31	0.24
32	0.25
33	0.27
34	0.29
35	0.3
36	0.25
37	0.26
38	0.29
39	0.29
40	0.31
41	0.29
42	0.28
43	0.34
44	0.41
45	0.45
46	0.48
47	0.58
48	0.65
49	0.75
50	0.84
51	0.86
52	0.89
53	0.91
54	0.94
55	0.94
56	0.96
57	0.95
58	0.95
59	0.96
60	0.95
61	0.9
62	0.84
63	0.74
64	0.65
65	0.57
66	0.46
67	0.36
68	0.26
69	0.21
70	0.19
71	0.2
72	0.19
73	0.21
74	0.27
75	0.3
76	0.36
77	0.37
78	0.39
79	0.36
80	0.36
81	0.32
82	0.26
83	0.22
84	0.16
85	0.15
86	0.1
87	0.11
88	0.1
89	0.09
90	0.09
91	0.09
92	0.12
93	0.11
94	0.13
95	0.16
96	0.2
97	0.22
98	0.22
99	0.25
100	0.23
101	0.26
102	0.26
103	0.23
104	0.22
105	0.21
106	0.24
107	0.23
108	0.23
109	0.2
110	0.2
111	0.19
112	0.23
113	0.29
114	0.28
115	0.26
116	0.26
117	0.31
118	0.32
119	0.35
120	0.35
121	0.29
122	0.31
123	0.32
124	0.34
125	0.35
126	0.32
127	0.3
128	0.25
129	0.26
130	0.22
131	0.23
132	0.27
133	0.28
134	0.36
135	0.43
136	0.45
137	0.46
138	0.49
139	0.52
140	0.51
141	0.47
142	0.43
143	0.39
144	0.37
145	0.31
146	0.28
147	0.24
148	0.18
149	0.14
150	0.09
151	0.06
152	0.05
153	0.06
154	0.06
155	0.06
156	0.06
157	0.11
158	0.13
159	0.14
160	0.16
161	0.23
162	0.29
163	0.37
164	0.47
165	0.52
166	0.57
167	0.63
168	0.66
169	0.65
170	0.67
171	0.7
172	0.69
173	0.68
174	0.67
175	0.6
176	0.6
177	0.56
178	0.51
179	0.45
180	0.41
181	0.34
182	0.35
183	0.35
184	0.31
185	0.31
186	0.29
187	0.28
188	0.26
189	0.26
190	0.21
191	0.22
192	0.24
193	0.23
194	0.21
195	0.19
196	0.15
197	0.13
198	0.14
199	0.12
200	0.11
201	0.14
202	0.17
203	0.2
204	0.23
205	0.28
206	0.27
207	0.34
208	0.35
209	0.32
210	0.34
211	0.33
212	0.32
213	0.32
214	0.33
215	0.28
216	0.34
217	0.4
218	0.36
219	0.39
220	0.37
221	0.33
222	0.3
223	0.31
224	0.25
225	0.22
226	0.24
227	0.21
228	0.23
229	0.22
230	0.23
231	0.21
232	0.21
233	0.18
234	0.15
235	0.14
236	0.12
237	0.14
238	0.14
239	0.12
240	0.12
241	0.11
242	0.11
243	0.11
244	0.12
245	0.09
246	0.09
247	0.1
248	0.11
249	0.11
250	0.1
251	0.13
252	0.15
253	0.2
254	0.24
255	0.26
256	0.25
257	0.25
258	0.25
259	0.22
260	0.2
261	0.15
262	0.13
263	0.12
264	0.13
265	0.14
266	0.14
267	0.16
268	0.15
269	0.16
270	0.18
271	0.17
272	0.22
273	0.22
274	0.23
275	0.24
276	0.23
277	0.26
278	0.27
279	0.36
280	0.33
281	0.36
282	0.35
283	0.36
284	0.37
285	0.38
286	0.32
287	0.27
288	0.26
289	0.29
290	0.28
291	0.27
292	0.27
293	0.22
294	0.22
295	0.18
296	0.18
297	0.1
298	0.11
299	0.11
300	0.14
301	0.19
302	0.23
303	0.3
304	0.33
305	0.38
306	0.42
307	0.45
308	0.49
309	0.5
310	0.56
311	0.56
312	0.6
313	0.57
314	0.56
315	0.51
316	0.43
317	0.38
318	0.27
319	0.21
320	0.14
321	0.11
322	0.08
323	0.07
324	0.08
325	0.08
326	0.11
327	0.09
328	0.1
329	0.1
330	0.14
331	0.15
332	0.16
333	0.18
334	0.22
335	0.25
336	0.23
337	0.25
338	0.24
339	0.24
340	0.25
341	0.23
342	0.18
343	0.17
344	0.18
345	0.16
346	0.15
347	0.14
348	0.13
349	0.12
350	0.11
351	0.1
352	0.1
353	0.09
354	0.09
355	0.09
356	0.09
357	0.09
358	0.09
359	0.08
360	0.08
361	0.08
362	0.11
363	0.11
364	0.11
365	0.11
366	0.1
367	0.1
368	0.08
369	0.09
370	0.07
371	0.07
372	0.09
373	0.1
374	0.1
375	0.11
376	0.11
377	0.1
378	0.09
379	0.08
380	0.09
381	0.08
382	0.09
383	0.08
384	0.08
385	0.07
386	0.08
387	0.08
388	0.06
389	0.06
390	0.05
391	0.05
392	0.05
393	0.05
394	0.05
395	0.06
396	0.11
397	0.11
398	0.12
399	0.13
400	0.14
401	0.17
402	0.2
403	0.21
404	0.21
405	0.22
406	0.21
407	0.21
408	0.22
409	0.21
410	0.2
411	0.2
412	0.17
413	0.2
414	0.19
415	0.19
416	0.17
417	0.18
418	0.19
419	0.16
420	0.22
421	0.21
422	0.23
423	0.24
424	0.25
425	0.25
426	0.28
427	0.3
428	0.26
429	0.3
430	0.31
431	0.3
432	0.31
433	0.31
434	0.27
435	0.26
436	0.28
437	0.3
438	0.31
439	0.32
440	0.3
441	0.31
442	0.33
443	0.31
444	0.29
445	0.23
446	0.2
447	0.23
448	0.23
449	0.22
450	0.2
451	0.21
452	0.25
453	0.28
454	0.26
455	0.26
456	0.26
457	0.24
458	0.24
459	0.24
460	0.21
461	0.2
462	0.23
463	0.25
464	0.26
465	0.29
466	0.29
467	0.28
468	0.29
469	0.31
470	0.32
471	0.36
472	0.43
473	0.46
474	0.47
475	0.5
476	0.48
477	0.43
478	0.43
479	0.41
480	0.32
481	0.26
482	0.27
483	0.24
484	0.24
485	0.27
486	0.23
487	0.24
488	0.24
489	0.23
490	0.3
491	0.31
492	0.34
493	0.33
494	0.39
495	0.33
496	0.37
497	0.41
498	0.33
499	0.33
500	0.32
501	0.31
502	0.24
503	0.25
504	0.24
505	0.22
506	0.2
507	0.23
508	0.21
509	0.21
510	0.23
511	0.21
512	0.24
513	0.29
514	0.32
515	0.38
516	0.45
517	0.46
518	0.51
519	0.57
520	0.61
521	0.57
522	0.64
523	0.6
524	0.57
525	0.53
526	0.46
527	0.41
528	0.32
529	0.28
530	0.19
531	0.13
532	0.08
533	0.08
534	0.08
535	0.09
536	0.11
537	0.09
538	0.13
539	0.18
540	0.22
541	0.32
542	0.38
543	0.45
544	0.51
545	0.6
546	0.59
547	0.58
548	0.53
549	0.44
550	0.38
551	0.29
552	0.22
553	0.15
554	0.15
555	0.11
556	0.11
557	0.11
558	0.12
559	0.12
560	0.11
561	0.1
562	0.13
563	0.19
564	0.26
565	0.28
566	0.3
567	0.3
568	0.34
569	0.35
570	0.32
571	0.31
572	0.32
573	0.32
574	0.37
575	0.41
576	0.47
577	0.49
578	0.5
579	0.49
580	0.43
581	0.4
582	0.33
583	0.3
584	0.22
585	0.21
586	0.21
587	0.2
588	0.21
589	0.23
590	0.3
591	0.33
592	0.4
593	0.41

V2YRU7

3D AlphaFold-predicted Structure Viewer