Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2YIS3

Protein Details
Accession V2YIS3   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
91-124EYQPSQRVRKRRHGFLARKRSKGGRKILARRLAKBasic
NLS Segment(s)
PositionSequence
97-127RVRKRRHGFLARKRSKGGRKILARRLAKGRK
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mrr:Moror_2522  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPPSLCQLLSRSLRLQPEVPATGSRSLLSASYSHQITRPVTPLTQSSLRPRLSLAFNSTTSSPLQSLLLSPSPFFQQQQIRFAQRGTEYQPSQRVRKRRHGFLARKRSKGGRKILARRLAKGRKYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.38
4 0.38
5 0.37
6 0.33
7 0.34
8 0.33
9 0.31
10 0.28
11 0.28
12 0.27
13 0.26
14 0.22
15 0.17
16 0.15
17 0.14
18 0.13
19 0.11
20 0.11
21 0.14
22 0.14
23 0.14
24 0.16
25 0.19
26 0.2
27 0.22
28 0.22
29 0.21
30 0.2
31 0.21
32 0.21
33 0.21
34 0.23
35 0.23
36 0.27
37 0.32
38 0.32
39 0.31
40 0.3
41 0.29
42 0.28
43 0.27
44 0.25
45 0.21
46 0.21
47 0.22
48 0.21
49 0.19
50 0.17
51 0.15
52 0.11
53 0.09
54 0.09
55 0.07
56 0.08
57 0.09
58 0.11
59 0.1
60 0.1
61 0.1
62 0.12
63 0.13
64 0.13
65 0.16
66 0.21
67 0.24
68 0.28
69 0.32
70 0.33
71 0.33
72 0.32
73 0.3
74 0.25
75 0.25
76 0.25
77 0.28
78 0.27
79 0.3
80 0.38
81 0.39
82 0.46
83 0.5
84 0.55
85 0.56
86 0.66
87 0.7
88 0.7
89 0.77
90 0.79
91 0.83
92 0.84
93 0.88
94 0.85
95 0.82
96 0.78
97 0.77
98 0.75
99 0.73
100 0.72
101 0.71
102 0.73
103 0.78
104 0.82
105 0.83
106 0.77
107 0.75
108 0.76
109 0.76
110 0.71
111 0.7