Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WZP7

Protein Details
Accession V2WZP7   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSSKRGRKRNDNLPPNRARDVHydrophilic
NLS Segment(s)
PositionSequence
7-8RK
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
KEGG mrr:Moror_4618  -  
Amino Acid Sequences MSSKRGRKRNDNLPPNRARDVQRAFRARRAAHLQALEQRVAELEEENNCLRQALNLPAANRPPLGKGPTGKDKPKSIEPSTVSQHASLPLTLPLSSRDSSGSPPSTRMSSHSPPGSMGTSIGSRAPVQSVEDGVWEQTIIMSDSDLPSSSASSTYPLPPMSAPPPISSKPISYNPYPNSLSSSSSLPSSSRSMPSPMFLNSQPNYSHSADRPIGTSYGSPTFTMRSDIRDDSRHHYSYSPSPYQSHDTLHTHHGASAVAPGIAHSQSHPPQREPPVSYPHRRSLTEPQQAYSINSGFPHLPNPIHSNQGIRLPSPPRLPSQDGVAHNQPPRNYGPDGRINSMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.83
3 0.79
4 0.74
5 0.68
6 0.67
7 0.67
8 0.66
9 0.67
10 0.7
11 0.69
12 0.7
13 0.73
14 0.64
15 0.64
16 0.62
17 0.58
18 0.54
19 0.53
20 0.5
21 0.49
22 0.52
23 0.44
24 0.36
25 0.3
26 0.25
27 0.22
28 0.19
29 0.12
30 0.11
31 0.12
32 0.16
33 0.17
34 0.17
35 0.17
36 0.16
37 0.15
38 0.15
39 0.17
40 0.19
41 0.25
42 0.26
43 0.27
44 0.32
45 0.34
46 0.34
47 0.31
48 0.26
49 0.23
50 0.26
51 0.28
52 0.28
53 0.3
54 0.35
55 0.45
56 0.52
57 0.55
58 0.56
59 0.59
60 0.59
61 0.64
62 0.65
63 0.58
64 0.59
65 0.55
66 0.55
67 0.53
68 0.51
69 0.43
70 0.36
71 0.34
72 0.28
73 0.25
74 0.2
75 0.16
76 0.14
77 0.14
78 0.13
79 0.12
80 0.13
81 0.16
82 0.16
83 0.15
84 0.16
85 0.16
86 0.18
87 0.24
88 0.25
89 0.22
90 0.24
91 0.25
92 0.25
93 0.25
94 0.26
95 0.28
96 0.27
97 0.32
98 0.32
99 0.3
100 0.3
101 0.31
102 0.28
103 0.21
104 0.17
105 0.13
106 0.11
107 0.11
108 0.11
109 0.09
110 0.09
111 0.09
112 0.09
113 0.08
114 0.09
115 0.09
116 0.09
117 0.08
118 0.09
119 0.09
120 0.08
121 0.07
122 0.06
123 0.05
124 0.04
125 0.05
126 0.05
127 0.04
128 0.05
129 0.05
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.07
140 0.09
141 0.09
142 0.11
143 0.11
144 0.11
145 0.11
146 0.13
147 0.13
148 0.16
149 0.16
150 0.15
151 0.19
152 0.2
153 0.22
154 0.21
155 0.21
156 0.21
157 0.26
158 0.28
159 0.26
160 0.32
161 0.31
162 0.35
163 0.35
164 0.31
165 0.29
166 0.27
167 0.26
168 0.2
169 0.2
170 0.15
171 0.14
172 0.15
173 0.11
174 0.12
175 0.14
176 0.14
177 0.15
178 0.15
179 0.18
180 0.18
181 0.19
182 0.18
183 0.17
184 0.18
185 0.17
186 0.22
187 0.2
188 0.22
189 0.21
190 0.21
191 0.25
192 0.24
193 0.26
194 0.21
195 0.27
196 0.25
197 0.25
198 0.25
199 0.2
200 0.19
201 0.17
202 0.16
203 0.13
204 0.14
205 0.15
206 0.14
207 0.13
208 0.15
209 0.14
210 0.18
211 0.16
212 0.16
213 0.2
214 0.22
215 0.25
216 0.28
217 0.31
218 0.33
219 0.39
220 0.37
221 0.34
222 0.33
223 0.34
224 0.36
225 0.4
226 0.38
227 0.33
228 0.34
229 0.36
230 0.39
231 0.37
232 0.32
233 0.3
234 0.28
235 0.29
236 0.32
237 0.31
238 0.26
239 0.25
240 0.23
241 0.18
242 0.16
243 0.15
244 0.11
245 0.09
246 0.08
247 0.08
248 0.09
249 0.09
250 0.09
251 0.09
252 0.15
253 0.21
254 0.3
255 0.33
256 0.33
257 0.41
258 0.49
259 0.54
260 0.53
261 0.52
262 0.54
263 0.59
264 0.65
265 0.64
266 0.65
267 0.64
268 0.6
269 0.61
270 0.61
271 0.64
272 0.64
273 0.59
274 0.51
275 0.5
276 0.49
277 0.45
278 0.38
279 0.29
280 0.21
281 0.2
282 0.21
283 0.19
284 0.19
285 0.2
286 0.19
287 0.19
288 0.22
289 0.28
290 0.28
291 0.31
292 0.31
293 0.31
294 0.31
295 0.37
296 0.34
297 0.29
298 0.34
299 0.33
300 0.39
301 0.42
302 0.42
303 0.41
304 0.46
305 0.51
306 0.46
307 0.48
308 0.5
309 0.46
310 0.5
311 0.5
312 0.49
313 0.49
314 0.52
315 0.46
316 0.42
317 0.43
318 0.41
319 0.4
320 0.38
321 0.41
322 0.46
323 0.5