Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2X9V1

Protein Details
Accession V2X9V1    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSSALRTSPRRRHRHHPYPRPIYLNPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 6, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
KEGG mrr:Moror_8652  -  
Amino Acid Sequences MSSALRTSPRRRHRHHPYPRPIYLNPIGEDTAYEPRVDSLRDIMRSIEPGAVAKVDRDKEQQKAGQEGNNRLVVGGVLLLVRVSTFFTCSMLTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.89
4 0.89
5 0.88
6 0.87
7 0.83
8 0.72
9 0.69
10 0.64
11 0.56
12 0.46
13 0.39
14 0.33
15 0.27
16 0.26
17 0.21
18 0.2
19 0.16
20 0.15
21 0.12
22 0.13
23 0.14
24 0.14
25 0.12
26 0.12
27 0.15
28 0.16
29 0.16
30 0.17
31 0.16
32 0.17
33 0.17
34 0.13
35 0.09
36 0.08
37 0.08
38 0.08
39 0.07
40 0.07
41 0.1
42 0.11
43 0.13
44 0.19
45 0.22
46 0.25
47 0.3
48 0.32
49 0.31
50 0.35
51 0.35
52 0.34
53 0.36
54 0.37
55 0.36
56 0.35
57 0.32
58 0.27
59 0.25
60 0.2
61 0.15
62 0.1
63 0.06
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.06
71 0.06
72 0.08
73 0.09
74 0.11