Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WP23

Protein Details
Accession V2WP23   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-85IWAFRRLKKQKEWQRNYVREAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, mito 6, plas 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mrr:Moror_15476  -  
Amino Acid Sequences MASQTRLFHGAFIATMLSLVWAQSPPSSSDFDDARNRARSSFNRAALIIGLVVGIGALLSVGALIWAFRRLKKQKEWQRNYVREAQARAAAQQPPQYTPADPAGNPGNPYVPGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.05
6 0.05
7 0.06
8 0.06
9 0.07
10 0.08
11 0.1
12 0.11
13 0.14
14 0.16
15 0.16
16 0.19
17 0.19
18 0.23
19 0.28
20 0.28
21 0.31
22 0.34
23 0.34
24 0.32
25 0.38
26 0.36
27 0.39
28 0.45
29 0.42
30 0.38
31 0.37
32 0.36
33 0.29
34 0.26
35 0.16
36 0.08
37 0.05
38 0.03
39 0.03
40 0.02
41 0.02
42 0.01
43 0.01
44 0.01
45 0.01
46 0.01
47 0.01
48 0.01
49 0.01
50 0.01
51 0.02
52 0.02
53 0.07
54 0.08
55 0.1
56 0.2
57 0.26
58 0.33
59 0.42
60 0.52
61 0.59
62 0.7
63 0.76
64 0.77
65 0.82
66 0.81
67 0.77
68 0.76
69 0.71
70 0.64
71 0.59
72 0.51
73 0.44
74 0.39
75 0.35
76 0.31
77 0.28
78 0.26
79 0.29
80 0.28
81 0.26
82 0.28
83 0.28
84 0.25
85 0.26
86 0.29
87 0.27
88 0.25
89 0.27
90 0.3
91 0.31
92 0.31
93 0.29
94 0.25