Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WRD0

Protein Details
Accession V2WRD0   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-36RDCPDAPKKEEKKKEEQFAKBasic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 7, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0003964  F:RNA-directed DNA polymerase activity  
GO:0008270  F:zinc ion binding  
KEGG mrr:Moror_5629  -  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MAKGLCFQCGRGGHQIRDCPDAPKKEEKKKEEQFAKIRALVNDQTEEEKNLLINLMEQEAMDPVKLAGIAKWEPPKTVKGVHAFLGFGNFYQKFIGKYAQLARPLNDLTKKSQKFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.48
4 0.51
5 0.47
6 0.43
7 0.45
8 0.46
9 0.45
10 0.5
11 0.56
12 0.61
13 0.7
14 0.71
15 0.74
16 0.76
17 0.81
18 0.78
19 0.77
20 0.74
21 0.7
22 0.68
23 0.61
24 0.55
25 0.46
26 0.42
27 0.36
28 0.31
29 0.26
30 0.23
31 0.21
32 0.19
33 0.2
34 0.16
35 0.13
36 0.11
37 0.09
38 0.09
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.04
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.07
56 0.08
57 0.12
58 0.18
59 0.18
60 0.2
61 0.22
62 0.24
63 0.23
64 0.27
65 0.28
66 0.28
67 0.29
68 0.3
69 0.29
70 0.27
71 0.24
72 0.23
73 0.18
74 0.13
75 0.16
76 0.14
77 0.13
78 0.15
79 0.16
80 0.15
81 0.17
82 0.21
83 0.16
84 0.22
85 0.28
86 0.32
87 0.37
88 0.38
89 0.38
90 0.39
91 0.4
92 0.41
93 0.41
94 0.38
95 0.39
96 0.48