Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2Y0J5

Protein Details
Accession V2Y0J5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-37TKAKRKAAEKAEKAPRKPKKDPKAPKRALSAYBasic
NLS Segment(s)
PositionSequence
7-32KAKRKAAEKAEKAPRKPKKDPKAPKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG mrr:Moror_35  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKETTKAKRKAAEKAEKAPRKPKKDPKAPKRALSAYMFFSQDWRERIKAENPDASFGEVGKLLGAKWKELDDEEKKPYIEQAAKDKERAEGEKIAYDSGKKSAENSDKDEADGGKDEDESDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.79
4 0.79
5 0.8
6 0.8
7 0.79
8 0.78
9 0.81
10 0.82
11 0.82
12 0.85
13 0.9
14 0.9
15 0.92
16 0.9
17 0.85
18 0.82
19 0.75
20 0.69
21 0.62
22 0.53
23 0.46
24 0.41
25 0.35
26 0.27
27 0.25
28 0.23
29 0.23
30 0.22
31 0.22
32 0.2
33 0.2
34 0.24
35 0.29
36 0.33
37 0.33
38 0.36
39 0.33
40 0.35
41 0.34
42 0.31
43 0.24
44 0.17
45 0.14
46 0.08
47 0.08
48 0.05
49 0.05
50 0.04
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.1
57 0.11
58 0.18
59 0.19
60 0.24
61 0.27
62 0.28
63 0.28
64 0.27
65 0.27
66 0.26
67 0.24
68 0.23
69 0.29
70 0.36
71 0.38
72 0.39
73 0.39
74 0.37
75 0.38
76 0.37
77 0.32
78 0.27
79 0.27
80 0.3
81 0.3
82 0.27
83 0.24
84 0.23
85 0.2
86 0.2
87 0.21
88 0.17
89 0.18
90 0.27
91 0.34
92 0.37
93 0.41
94 0.44
95 0.42
96 0.42
97 0.43
98 0.34
99 0.28
100 0.27
101 0.22
102 0.16
103 0.16