Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2XSD2

Protein Details
Accession V2XSD2   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-35IPSSYQLRDSRRRRHPYLRCPICCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 9, mito 8, cyto 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mrr:Moror_6877  -  
Amino Acid Sequences MVIIKTSPSLRIPSSYQLRDSRRRRHPYLRCPICCDEEDGPYVPRIMDDELHLVQDVLQAERRRILERDANADEEREGDIMEVRALVILYLVLLTTMLVRHLLMMGLLYRIASGTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.44
4 0.49
5 0.55
6 0.61
7 0.67
8 0.69
9 0.71
10 0.77
11 0.79
12 0.81
13 0.84
14 0.84
15 0.87
16 0.87
17 0.79
18 0.77
19 0.73
20 0.66
21 0.56
22 0.5
23 0.41
24 0.32
25 0.31
26 0.25
27 0.22
28 0.19
29 0.18
30 0.13
31 0.11
32 0.1
33 0.09
34 0.08
35 0.08
36 0.11
37 0.11
38 0.11
39 0.11
40 0.1
41 0.09
42 0.1
43 0.09
44 0.07
45 0.11
46 0.11
47 0.12
48 0.15
49 0.16
50 0.17
51 0.17
52 0.2
53 0.22
54 0.23
55 0.29
56 0.27
57 0.29
58 0.27
59 0.27
60 0.23
61 0.18
62 0.17
63 0.11
64 0.09
65 0.06
66 0.07
67 0.07
68 0.07
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.02
80 0.03
81 0.03
82 0.03
83 0.04
84 0.05
85 0.05
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.07
95 0.07
96 0.06