Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WTL8

Protein Details
Accession V2WTL8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-37NVTPRRSKRIASKKARSVLLHydrophilic
NLS Segment(s)
PositionSequence
20-82TPRRSKRIASKKARSVLLARKGKGKAAIFPTPKSARTTKAKKSKYSFQVPPRPKSAGGGRRVR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
KEGG mrr:Moror_9258  -  
Amino Acid Sequences MVTTRSQAAKRRQPAETNVTPRRSKRIASKKARSVLLARKGKGKAAIFPTPKSARTTKAKKSKYSFQVPPRPKSAGGGRRVRLATPLLDGSGQRGWPLTPKAPRKPTQSLPRPILKPNYPARLSAPSSSFNDDERMTLTPTAHNSHVGNHMPARDETPLLGSPSQHTRPSPHDFCDGIPGTWTRSPSGTRRLVVIPDDVSAEANRERESRKQTRYDEIFREQYDLLMKGREESDRNVRGMLRNPDAMDCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.7
4 0.69
5 0.68
6 0.7
7 0.7
8 0.67
9 0.68
10 0.63
11 0.59
12 0.6
13 0.63
14 0.67
15 0.72
16 0.78
17 0.79
18 0.82
19 0.78
20 0.71
21 0.67
22 0.66
23 0.65
24 0.63
25 0.55
26 0.56
27 0.55
28 0.54
29 0.53
30 0.46
31 0.42
32 0.41
33 0.49
34 0.45
35 0.45
36 0.5
37 0.46
38 0.47
39 0.45
40 0.41
41 0.39
42 0.46
43 0.54
44 0.55
45 0.63
46 0.68
47 0.71
48 0.75
49 0.78
50 0.76
51 0.76
52 0.75
53 0.75
54 0.78
55 0.77
56 0.75
57 0.7
58 0.64
59 0.55
60 0.51
61 0.5
62 0.48
63 0.48
64 0.52
65 0.48
66 0.51
67 0.51
68 0.47
69 0.4
70 0.33
71 0.26
72 0.2
73 0.19
74 0.14
75 0.14
76 0.13
77 0.13
78 0.13
79 0.12
80 0.1
81 0.1
82 0.09
83 0.13
84 0.16
85 0.19
86 0.26
87 0.34
88 0.42
89 0.5
90 0.55
91 0.59
92 0.62
93 0.65
94 0.67
95 0.69
96 0.67
97 0.65
98 0.66
99 0.61
100 0.58
101 0.55
102 0.47
103 0.45
104 0.43
105 0.46
106 0.4
107 0.38
108 0.37
109 0.37
110 0.36
111 0.31
112 0.27
113 0.23
114 0.23
115 0.25
116 0.23
117 0.18
118 0.19
119 0.17
120 0.15
121 0.14
122 0.13
123 0.12
124 0.12
125 0.12
126 0.11
127 0.13
128 0.16
129 0.15
130 0.16
131 0.15
132 0.16
133 0.21
134 0.2
135 0.19
136 0.18
137 0.18
138 0.18
139 0.18
140 0.18
141 0.14
142 0.13
143 0.12
144 0.13
145 0.14
146 0.14
147 0.14
148 0.12
149 0.14
150 0.2
151 0.23
152 0.23
153 0.22
154 0.24
155 0.31
156 0.39
157 0.4
158 0.36
159 0.37
160 0.36
161 0.35
162 0.39
163 0.34
164 0.25
165 0.24
166 0.22
167 0.21
168 0.23
169 0.23
170 0.17
171 0.18
172 0.21
173 0.25
174 0.33
175 0.34
176 0.33
177 0.35
178 0.36
179 0.36
180 0.34
181 0.31
182 0.23
183 0.18
184 0.19
185 0.16
186 0.15
187 0.13
188 0.14
189 0.13
190 0.14
191 0.15
192 0.17
193 0.2
194 0.27
195 0.36
196 0.43
197 0.49
198 0.56
199 0.59
200 0.66
201 0.71
202 0.71
203 0.68
204 0.66
205 0.64
206 0.56
207 0.55
208 0.45
209 0.39
210 0.35
211 0.3
212 0.24
213 0.21
214 0.21
215 0.2
216 0.22
217 0.24
218 0.24
219 0.28
220 0.37
221 0.39
222 0.4
223 0.4
224 0.4
225 0.41
226 0.47
227 0.49
228 0.44
229 0.43
230 0.43