Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2YLS3

Protein Details
Accession V2YLS3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-36AFPSWEKRVSRRQCSRPCERRRTIQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10.833, mito 6.5, cyto_mito 5.833
Family & Domain DBs
KEGG mrr:Moror_4332  -  
Amino Acid Sequences MYGAYLVLGPPAFPSWEKRVSRRQCSRPCERRRTIQVDYTSKNEQFVLFVLETDCERRQNQRAEACAQANPNRLSKPRYKSNSPALSPALSPAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.31
4 0.35
5 0.4
6 0.49
7 0.57
8 0.67
9 0.71
10 0.76
11 0.76
12 0.81
13 0.86
14 0.85
15 0.86
16 0.86
17 0.81
18 0.8
19 0.79
20 0.78
21 0.71
22 0.67
23 0.65
24 0.61
25 0.57
26 0.52
27 0.47
28 0.4
29 0.36
30 0.3
31 0.22
32 0.16
33 0.14
34 0.13
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.11
41 0.12
42 0.12
43 0.13
44 0.18
45 0.25
46 0.3
47 0.37
48 0.38
49 0.41
50 0.41
51 0.44
52 0.41
53 0.36
54 0.35
55 0.33
56 0.35
57 0.34
58 0.34
59 0.34
60 0.37
61 0.4
62 0.44
63 0.48
64 0.52
65 0.57
66 0.61
67 0.65
68 0.72
69 0.76
70 0.69
71 0.66
72 0.59
73 0.53
74 0.46