Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WKS7

Protein Details
Accession V2WKS7    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
165-192DYVRSCTDCGRNKLRRHQPYRMLKPLPVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8, cyto_nucl 7.333, cyto 4.5, cyto_pero 3.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR041588  Integrase_H2C2  
KEGG mrr:Moror_6028  -  
Pfam View protein in Pfam  
PF17921  Integrase_H2C2  
Amino Acid Sequences MVIRFWPGRLGAKPDALTRRWDVYPKEGDTSYVSVNPQNLRPIFTEEQLISSLRATYLEEPVLRASVLMDIEKLHSDIRTALPSDPEAVAGMQHAQKGHNRWTIDDSGLLRLDNRIFVPLADDLCLQVCKHHHDHVLASHFGQNRTLAIIRRSYTWPRIWDFVKDYVRSCTDCGRNKLRRHQPYRMLKPLPVPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.42
4 0.43
5 0.4
6 0.41
7 0.38
8 0.43
9 0.39
10 0.41
11 0.47
12 0.44
13 0.44
14 0.39
15 0.38
16 0.36
17 0.34
18 0.28
19 0.23
20 0.22
21 0.2
22 0.24
23 0.24
24 0.24
25 0.29
26 0.27
27 0.27
28 0.28
29 0.34
30 0.32
31 0.3
32 0.31
33 0.24
34 0.24
35 0.23
36 0.22
37 0.15
38 0.13
39 0.12
40 0.09
41 0.09
42 0.1
43 0.1
44 0.12
45 0.13
46 0.13
47 0.13
48 0.14
49 0.14
50 0.12
51 0.1
52 0.08
53 0.07
54 0.08
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.09
61 0.08
62 0.07
63 0.08
64 0.09
65 0.1
66 0.11
67 0.12
68 0.12
69 0.12
70 0.13
71 0.14
72 0.12
73 0.1
74 0.09
75 0.07
76 0.07
77 0.06
78 0.07
79 0.07
80 0.07
81 0.08
82 0.09
83 0.12
84 0.15
85 0.2
86 0.23
87 0.23
88 0.23
89 0.26
90 0.27
91 0.24
92 0.23
93 0.18
94 0.16
95 0.16
96 0.15
97 0.11
98 0.11
99 0.11
100 0.1
101 0.09
102 0.08
103 0.08
104 0.08
105 0.1
106 0.1
107 0.1
108 0.09
109 0.09
110 0.08
111 0.09
112 0.1
113 0.08
114 0.1
115 0.11
116 0.16
117 0.19
118 0.23
119 0.25
120 0.26
121 0.29
122 0.31
123 0.34
124 0.29
125 0.26
126 0.27
127 0.27
128 0.26
129 0.25
130 0.2
131 0.16
132 0.18
133 0.2
134 0.18
135 0.18
136 0.22
137 0.22
138 0.25
139 0.3
140 0.33
141 0.36
142 0.39
143 0.42
144 0.4
145 0.45
146 0.43
147 0.44
148 0.42
149 0.45
150 0.46
151 0.43
152 0.41
153 0.41
154 0.43
155 0.39
156 0.37
157 0.37
158 0.39
159 0.45
160 0.51
161 0.56
162 0.62
163 0.69
164 0.78
165 0.8
166 0.82
167 0.83
168 0.85
169 0.85
170 0.87
171 0.89
172 0.88
173 0.81
174 0.73