Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2YU18

Protein Details
Accession V2YU18    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
107-131ELFAKAKGIQRKRRDKKVWDEERQEBasic
NLS Segment(s)
PositionSequence
93-123RAKPLPKPKPPTKWELFAKAKGIQRKRRDKK
295-310GRAVSGGKGKKVGKRK
Subcellular Location(s) nucl 15.5, mito_nucl 9.5, cyto 7, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG mrr:Moror_13866  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MDVSNILASHAEKYQSVTVEKETPFDVDVGFLTVTDPNPIDEETYSANVEEHLQSLARDGVQNLLAKIFSLPTESSPDGPLAQLPPPITQLPRAKPLPKPKPPTKWELFAKAKGIQRKRRDKKVWDEERQEWVNRWGKDGKNKQLEEQWITEVPLNADPDYDPRKVAKAERKERVANNEKQRLANIARAQQVAGAREERKGEIDRTLATSRVSTASMGKFDKKLEGEKKLQGVKRKFQPNEKPVEQEKKASLALLSRMESDSKMMRREPVPEESVFDVRKAVRHASKGQGGVALGRAVSGGKGKKVGKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.25
4 0.25
5 0.26
6 0.32
7 0.32
8 0.3
9 0.27
10 0.25
11 0.24
12 0.22
13 0.18
14 0.12
15 0.11
16 0.12
17 0.1
18 0.09
19 0.09
20 0.1
21 0.11
22 0.12
23 0.12
24 0.11
25 0.13
26 0.13
27 0.14
28 0.12
29 0.14
30 0.14
31 0.16
32 0.15
33 0.14
34 0.14
35 0.13
36 0.15
37 0.13
38 0.11
39 0.1
40 0.1
41 0.1
42 0.12
43 0.12
44 0.11
45 0.11
46 0.11
47 0.12
48 0.15
49 0.17
50 0.15
51 0.15
52 0.14
53 0.13
54 0.13
55 0.11
56 0.08
57 0.1
58 0.1
59 0.11
60 0.17
61 0.18
62 0.19
63 0.19
64 0.2
65 0.17
66 0.16
67 0.16
68 0.12
69 0.13
70 0.14
71 0.14
72 0.14
73 0.17
74 0.18
75 0.18
76 0.23
77 0.29
78 0.3
79 0.36
80 0.4
81 0.41
82 0.47
83 0.57
84 0.6
85 0.63
86 0.69
87 0.7
88 0.76
89 0.76
90 0.78
91 0.71
92 0.69
93 0.64
94 0.64
95 0.6
96 0.53
97 0.52
98 0.49
99 0.49
100 0.49
101 0.53
102 0.53
103 0.58
104 0.67
105 0.72
106 0.77
107 0.81
108 0.81
109 0.83
110 0.85
111 0.85
112 0.82
113 0.8
114 0.72
115 0.71
116 0.65
117 0.55
118 0.45
119 0.43
120 0.41
121 0.34
122 0.34
123 0.34
124 0.34
125 0.43
126 0.49
127 0.5
128 0.52
129 0.53
130 0.51
131 0.5
132 0.51
133 0.44
134 0.37
135 0.3
136 0.21
137 0.22
138 0.21
139 0.16
140 0.13
141 0.12
142 0.12
143 0.1
144 0.1
145 0.09
146 0.12
147 0.16
148 0.16
149 0.14
150 0.14
151 0.16
152 0.18
153 0.25
154 0.29
155 0.36
156 0.44
157 0.49
158 0.53
159 0.57
160 0.58
161 0.61
162 0.61
163 0.58
164 0.59
165 0.61
166 0.57
167 0.53
168 0.51
169 0.46
170 0.39
171 0.37
172 0.31
173 0.28
174 0.29
175 0.28
176 0.28
177 0.25
178 0.25
179 0.2
180 0.19
181 0.17
182 0.15
183 0.17
184 0.19
185 0.17
186 0.19
187 0.2
188 0.19
189 0.18
190 0.19
191 0.18
192 0.22
193 0.22
194 0.2
195 0.18
196 0.17
197 0.16
198 0.15
199 0.15
200 0.11
201 0.14
202 0.14
203 0.18
204 0.2
205 0.21
206 0.22
207 0.22
208 0.26
209 0.24
210 0.32
211 0.34
212 0.39
213 0.42
214 0.45
215 0.5
216 0.53
217 0.54
218 0.55
219 0.56
220 0.58
221 0.62
222 0.67
223 0.66
224 0.69
225 0.76
226 0.74
227 0.76
228 0.71
229 0.68
230 0.66
231 0.71
232 0.62
233 0.57
234 0.51
235 0.45
236 0.42
237 0.36
238 0.29
239 0.23
240 0.25
241 0.23
242 0.22
243 0.2
244 0.21
245 0.21
246 0.2
247 0.2
248 0.23
249 0.24
250 0.27
251 0.27
252 0.32
253 0.33
254 0.38
255 0.4
256 0.4
257 0.4
258 0.36
259 0.38
260 0.36
261 0.4
262 0.35
263 0.3
264 0.27
265 0.25
266 0.28
267 0.28
268 0.32
269 0.33
270 0.38
271 0.44
272 0.48
273 0.53
274 0.5
275 0.47
276 0.42
277 0.36
278 0.31
279 0.27
280 0.2
281 0.13
282 0.12
283 0.11
284 0.09
285 0.1
286 0.15
287 0.17
288 0.19
289 0.27
290 0.32