Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WLZ4

Protein Details
Accession V2WLZ4   
Localization Confidence High
Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKGKNKGGRPLKKKHNGCNVSGHydrophilic
147-166AENRCRRKQLKGGWPKEYKKBasic
NLS Segment(s)
PositionSequence
3-15KGKNKGGRPLKKK
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
KEGG mrr:Moror_2256  -  
Amino Acid Sequences MAKGKNKGGRPLKKKHNGCNVSGLCNQKKRSLSPALSDDRECVKKKSRGKDEDVDSVLEDISAEHDLMRLAERYGDLDEMDWFGESGPDLVAEDEQAREVDEGEYWEDKDWEEELADEELMGQLAKLVKLLRDDPRDEDWVPVQVQAENRCRRKQLKGGWPKEYKKGLDVASKSEQTQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.87
4 0.82
5 0.75
6 0.76
7 0.67
8 0.62
9 0.59
10 0.57
11 0.54
12 0.56
13 0.56
14 0.52
15 0.53
16 0.51
17 0.53
18 0.54
19 0.49
20 0.48
21 0.53
22 0.52
23 0.51
24 0.48
25 0.43
26 0.4
27 0.43
28 0.39
29 0.37
30 0.4
31 0.45
32 0.53
33 0.61
34 0.65
35 0.67
36 0.71
37 0.74
38 0.7
39 0.68
40 0.61
41 0.51
42 0.41
43 0.34
44 0.26
45 0.18
46 0.13
47 0.06
48 0.06
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.08
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.04
78 0.03
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.05
88 0.05
89 0.06
90 0.07
91 0.08
92 0.08
93 0.08
94 0.08
95 0.08
96 0.09
97 0.08
98 0.07
99 0.07
100 0.06
101 0.08
102 0.08
103 0.08
104 0.06
105 0.06
106 0.06
107 0.06
108 0.05
109 0.03
110 0.04
111 0.05
112 0.06
113 0.07
114 0.08
115 0.09
116 0.12
117 0.17
118 0.23
119 0.27
120 0.3
121 0.33
122 0.37
123 0.4
124 0.37
125 0.35
126 0.29
127 0.28
128 0.26
129 0.23
130 0.2
131 0.18
132 0.21
133 0.26
134 0.34
135 0.4
136 0.46
137 0.49
138 0.56
139 0.59
140 0.64
141 0.66
142 0.67
143 0.69
144 0.74
145 0.77
146 0.8
147 0.84
148 0.8
149 0.79
150 0.76
151 0.67
152 0.59
153 0.57
154 0.52
155 0.51
156 0.49
157 0.46
158 0.46
159 0.46