Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2X9Y3

Protein Details
Accession V2X9Y3    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
81-122PLDLRPKKTRAIRRRLTKHEKSLKTAKQTKKDQNFPIRKYAVHydrophilic
NLS Segment(s)
PositionSequence
84-111LRPKKTRAIRRRLTKHEKSLKTAKQTKK
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG mrr:Moror_7343  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKADLSKQLSELKQELLALRVQKIAGGSASKLTKINTVRKSIARVMTVMNQKTRQNLREYYKGKKYLPLDLRPKKTRAIRRRLTKHEKSLKTAKQTKKDQNFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.39
4 0.44
5 0.41
6 0.43
7 0.44
8 0.48
9 0.43
10 0.44
11 0.43
12 0.35
13 0.3
14 0.25
15 0.22
16 0.17
17 0.19
18 0.16
19 0.16
20 0.15
21 0.14
22 0.14
23 0.13
24 0.12
25 0.11
26 0.1
27 0.09
28 0.12
29 0.13
30 0.13
31 0.14
32 0.14
33 0.19
34 0.23
35 0.32
36 0.32
37 0.36
38 0.39
39 0.39
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.23
46 0.26
47 0.29
48 0.27
49 0.25
50 0.25
51 0.26
52 0.31
53 0.34
54 0.31
55 0.31
56 0.36
57 0.38
58 0.45
59 0.47
60 0.48
61 0.52
62 0.55
63 0.5
64 0.5
65 0.47
66 0.47
67 0.51
68 0.53
69 0.56
70 0.59
71 0.67
72 0.66
73 0.66
74 0.64
75 0.66
76 0.67
77 0.67
78 0.69
79 0.7
80 0.76
81 0.83
82 0.87
83 0.88
84 0.87
85 0.87
86 0.87
87 0.82
88 0.79
89 0.79
90 0.75
91 0.75
92 0.76
93 0.74
94 0.74
95 0.79
96 0.83
97 0.83
98 0.85
99 0.84
100 0.86
101 0.87
102 0.81
103 0.81
104 0.75