Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2Y7T4

Protein Details
Accession V2Y7T4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MSDTPTTQTRKPKHRGGRRRYGSRVPSQSHydrophilic
NLS Segment(s)
PositionSequence
10-22RKPKHRGGRRRYG
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
KEGG mrr:Moror_1830  -  
Amino Acid Sequences MSDTPTTQTRKPKHRGGRRRYGSRVPSQSPSSSQSPAPRQRKSGGLPLNPAQLVDGLPLNPNQLVDGLPLNPNQLVDPLNKIGNGLSNGLPLHDQLPGIDEFDSAIAHKNKARDAAEERALALRLDVNLDVVVSLRATVHGDLTVSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.87
4 0.89
5 0.88
6 0.9
7 0.87
8 0.86
9 0.82
10 0.81
11 0.8
12 0.73
13 0.68
14 0.63
15 0.58
16 0.52
17 0.49
18 0.42
19 0.36
20 0.35
21 0.37
22 0.42
23 0.5
24 0.55
25 0.54
26 0.54
27 0.55
28 0.58
29 0.54
30 0.54
31 0.51
32 0.45
33 0.46
34 0.44
35 0.45
36 0.38
37 0.34
38 0.25
39 0.18
40 0.15
41 0.11
42 0.09
43 0.06
44 0.07
45 0.08
46 0.08
47 0.08
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.08
61 0.08
62 0.08
63 0.08
64 0.1
65 0.11
66 0.11
67 0.11
68 0.11
69 0.1
70 0.11
71 0.11
72 0.11
73 0.1
74 0.11
75 0.11
76 0.11
77 0.11
78 0.09
79 0.09
80 0.07
81 0.07
82 0.06
83 0.08
84 0.08
85 0.09
86 0.09
87 0.08
88 0.07
89 0.08
90 0.08
91 0.06
92 0.12
93 0.12
94 0.14
95 0.17
96 0.19
97 0.21
98 0.27
99 0.28
100 0.27
101 0.31
102 0.36
103 0.38
104 0.36
105 0.35
106 0.31
107 0.3
108 0.24
109 0.19
110 0.14
111 0.1
112 0.12
113 0.11
114 0.1
115 0.09
116 0.09
117 0.08
118 0.07
119 0.08
120 0.06
121 0.06
122 0.05
123 0.06
124 0.09
125 0.09
126 0.1
127 0.1
128 0.1