Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WGP7

Protein Details
Accession V2WGP7    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
34-61ELAIKRAKAAERQRRKRERDRNGGLNMVHydrophilic
NLS Segment(s)
PositionSequence
38-53KRAKAAERQRRKRERD
117-140RRERVRAAARERQRKHRALIKERK
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
KEGG mrr:Moror_9406  -  
Amino Acid Sequences MDPTAPNGLSTPLPVMSPQSLGKRSRDPENVTPELAIKRAKAAERQRRKRERDRNGGLNMVSVNQNQHNQGQSQPDLYVQFPQQSFLPIHHHIPQQSRPSNSHRTDPEDLTPEEVARRERVRAAARERQRKHRALIKERKMQALGLDMGNEAIPTQMGEGELQLGVDGQGPQLQQQQFHQLSQQQPHMVYQSALNTDPERIPANVQAASPGQMFATTLLLSFSCAPLLKEHLLNNLQMTDQELASLEPLIAEAWEQWDRQRRQQYVQPPPLNTAASPSEAFTPDTASSTTASTPTSTTGEPSNEFRARFRKPVLAPSPFQAQSPVDDSVIDPALSQGQGLKLEES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.16
4 0.19
5 0.22
6 0.27
7 0.33
8 0.37
9 0.42
10 0.47
11 0.49
12 0.55
13 0.59
14 0.6
15 0.61
16 0.66
17 0.64
18 0.56
19 0.52
20 0.47
21 0.4
22 0.36
23 0.3
24 0.21
25 0.24
26 0.28
27 0.3
28 0.35
29 0.45
30 0.52
31 0.62
32 0.72
33 0.78
34 0.84
35 0.9
36 0.92
37 0.92
38 0.92
39 0.92
40 0.9
41 0.87
42 0.81
43 0.76
44 0.64
45 0.55
46 0.45
47 0.35
48 0.28
49 0.21
50 0.2
51 0.19
52 0.22
53 0.22
54 0.25
55 0.25
56 0.24
57 0.27
58 0.29
59 0.27
60 0.26
61 0.24
62 0.23
63 0.22
64 0.22
65 0.22
66 0.17
67 0.21
68 0.2
69 0.21
70 0.19
71 0.2
72 0.2
73 0.19
74 0.24
75 0.21
76 0.25
77 0.28
78 0.31
79 0.32
80 0.38
81 0.42
82 0.45
83 0.48
84 0.48
85 0.48
86 0.52
87 0.58
88 0.54
89 0.54
90 0.48
91 0.5
92 0.51
93 0.49
94 0.45
95 0.4
96 0.38
97 0.33
98 0.3
99 0.23
100 0.2
101 0.2
102 0.18
103 0.18
104 0.19
105 0.18
106 0.2
107 0.26
108 0.3
109 0.35
110 0.4
111 0.45
112 0.52
113 0.61
114 0.63
115 0.68
116 0.71
117 0.69
118 0.66
119 0.65
120 0.66
121 0.67
122 0.73
123 0.72
124 0.72
125 0.7
126 0.67
127 0.6
128 0.51
129 0.4
130 0.33
131 0.25
132 0.16
133 0.14
134 0.11
135 0.1
136 0.1
137 0.09
138 0.05
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.03
152 0.03
153 0.04
154 0.04
155 0.04
156 0.06
157 0.06
158 0.07
159 0.12
160 0.13
161 0.13
162 0.14
163 0.22
164 0.21
165 0.22
166 0.23
167 0.22
168 0.25
169 0.28
170 0.29
171 0.22
172 0.22
173 0.22
174 0.22
175 0.18
176 0.14
177 0.12
178 0.12
179 0.12
180 0.12
181 0.12
182 0.11
183 0.12
184 0.12
185 0.13
186 0.12
187 0.11
188 0.12
189 0.13
190 0.15
191 0.14
192 0.14
193 0.14
194 0.13
195 0.14
196 0.13
197 0.11
198 0.08
199 0.07
200 0.07
201 0.06
202 0.07
203 0.05
204 0.05
205 0.06
206 0.06
207 0.07
208 0.07
209 0.07
210 0.07
211 0.07
212 0.08
213 0.08
214 0.13
215 0.14
216 0.16
217 0.17
218 0.21
219 0.23
220 0.23
221 0.22
222 0.19
223 0.17
224 0.14
225 0.15
226 0.11
227 0.09
228 0.09
229 0.08
230 0.08
231 0.08
232 0.08
233 0.05
234 0.04
235 0.05
236 0.04
237 0.04
238 0.04
239 0.04
240 0.08
241 0.09
242 0.1
243 0.14
244 0.24
245 0.28
246 0.36
247 0.45
248 0.45
249 0.49
250 0.56
251 0.62
252 0.63
253 0.71
254 0.68
255 0.6
256 0.6
257 0.57
258 0.51
259 0.4
260 0.34
261 0.25
262 0.22
263 0.21
264 0.19
265 0.18
266 0.18
267 0.19
268 0.15
269 0.17
270 0.15
271 0.16
272 0.16
273 0.14
274 0.14
275 0.14
276 0.15
277 0.12
278 0.13
279 0.12
280 0.12
281 0.14
282 0.16
283 0.14
284 0.16
285 0.18
286 0.21
287 0.23
288 0.26
289 0.32
290 0.33
291 0.34
292 0.38
293 0.42
294 0.45
295 0.49
296 0.49
297 0.5
298 0.49
299 0.59
300 0.62
301 0.6
302 0.57
303 0.53
304 0.57
305 0.49
306 0.46
307 0.39
308 0.32
309 0.29
310 0.31
311 0.29
312 0.21
313 0.21
314 0.21
315 0.21
316 0.21
317 0.17
318 0.13
319 0.12
320 0.14
321 0.14
322 0.14
323 0.12
324 0.13
325 0.16