Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2XAI8

Protein Details
Accession V2XAI8   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-86RAKVVPETKKDPKKPKPKPKPQPPQPKPQPQPEPEBasic
NLS Segment(s)
PositionSequence
18-83KSALSRSKAGGKKGGEWLTTRFRPKGPPDKIAGGRAKVVPETKKDPKKPKPKPKPQPPQPKPQPQP
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
KEGG mrr:Moror_4105  -  
Amino Acid Sequences MTLYLMKRLYKRVKYNIKSALSRSKAGGKKGGEWLTTRFRPKGPPDKIAGGRAKVVPETKKDPKKPKPKPKPQPPQPKPQPQPEPEPGNGGTSSGKTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.78
4 0.74
5 0.68
6 0.65
7 0.64
8 0.57
9 0.54
10 0.47
11 0.48
12 0.45
13 0.45
14 0.46
15 0.37
16 0.37
17 0.43
18 0.44
19 0.36
20 0.34
21 0.35
22 0.36
23 0.39
24 0.39
25 0.33
26 0.32
27 0.37
28 0.43
29 0.49
30 0.46
31 0.45
32 0.45
33 0.49
34 0.5
35 0.5
36 0.44
37 0.34
38 0.31
39 0.28
40 0.25
41 0.2
42 0.22
43 0.19
44 0.21
45 0.28
46 0.35
47 0.44
48 0.52
49 0.61
50 0.67
51 0.76
52 0.83
53 0.87
54 0.89
55 0.91
56 0.94
57 0.94
58 0.96
59 0.95
60 0.95
61 0.9
62 0.9
63 0.89
64 0.89
65 0.84
66 0.83
67 0.82
68 0.75
69 0.78
70 0.75
71 0.71
72 0.61
73 0.6
74 0.5
75 0.43
76 0.38
77 0.31
78 0.25
79 0.2