Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2XKQ8

Protein Details
Accession V2XKQ8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-35APSGGGKAAKKKKWSKGKVKDKAQHIVSHydrophilic
NLS Segment(s)
PositionSequence
5-29KAAAPSGGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG mrr:Moror_8875  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAAPSGGGKAAKKKKWSKGKVKDKAQHIVSLDKATYDRILKEVPTFRFISQSILIERLKINGSLARVAIRHLEKEGQIKKIVHHSSQLIYTRATAASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.4
3 0.44
4 0.5
5 0.58
6 0.63
7 0.73
8 0.81
9 0.82
10 0.84
11 0.9
12 0.9
13 0.91
14 0.88
15 0.84
16 0.82
17 0.72
18 0.65
19 0.56
20 0.49
21 0.4
22 0.34
23 0.28
24 0.2
25 0.18
26 0.15
27 0.15
28 0.13
29 0.12
30 0.12
31 0.12
32 0.12
33 0.16
34 0.21
35 0.2
36 0.22
37 0.23
38 0.22
39 0.24
40 0.23
41 0.22
42 0.18
43 0.18
44 0.15
45 0.17
46 0.17
47 0.16
48 0.15
49 0.14
50 0.14
51 0.12
52 0.12
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.12
59 0.13
60 0.17
61 0.17
62 0.17
63 0.18
64 0.2
65 0.21
66 0.3
67 0.34
68 0.32
69 0.35
70 0.35
71 0.36
72 0.43
73 0.45
74 0.38
75 0.39
76 0.38
77 0.35
78 0.41
79 0.42
80 0.34
81 0.3
82 0.29
83 0.27